mRNA_M-pyrifera_M_contig72625.17255.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig72625.17255.1 vs. uniprot
Match: D7FQW4_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FQW4_ECTSI) HSP 1 Score: 80.5 bits (197), Expect = 2.530e-17 Identity = 34/54 (62.96%), Postives = 41/54 (75.93%), Query Frame = 1 Query: 1 SQYISRSDFLGCGGRLGWPKLSCDELRDSDRENFPCLWRAGRMFKDTVAHSLPT 162 +QY+SR+D LGCGG+LGWPKL +LRD +RENF +WR GR FK TV SL T Sbjct: 144 AQYVSRTDILGCGGKLGWPKLDDYKLRDCERENFGFIWRTGRTFKHTVQESLET 197 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig72625.17255.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig72625.17255.1 >prot_M-pyrifera_M_contig72625.17255.1 ID=prot_M-pyrifera_M_contig72625.17255.1|Name=mRNA_M-pyrifera_M_contig72625.17255.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=54bp SQYISRSDFLGCGGRLGWPKLSCDELRDSDRENFPCLWRAGRMFKDTVAHback to top mRNA from alignment at M-pyrifera_M_contig72625:200..361+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig72625.17255.1 ID=mRNA_M-pyrifera_M_contig72625.17255.1|Name=mRNA_M-pyrifera_M_contig72625.17255.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=162bp|location=Sequence derived from alignment at M-pyrifera_M_contig72625:200..361+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig72625:200..361+ >mRNA_M-pyrifera_M_contig72625.17255.1 ID=mRNA_M-pyrifera_M_contig72625.17255.1|Name=mRNA_M-pyrifera_M_contig72625.17255.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=324bp|location=Sequence derived from alignment at M-pyrifera_M_contig72625:200..361+ (Macrocystis pyrifera P11B4 male)back to top |