mRNA_M-pyrifera_M_contig7256.17245.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig7256.17245.1 vs. uniprot
Match: D8LDN0_ECTSI (Zinc finger protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LDN0_ECTSI) HSP 1 Score: 101 bits (251), Expect = 4.440e-26 Identity = 45/46 (97.83%), Postives = 45/46 (97.83%), Query Frame = 1 Query: 1 VCFERKVDCTLVPCGHHCCCLICAAQFEQCPVCRADVEQKIRAISV 138 VCFERKVDCTLVPCGHHCCCL CAAQFEQCPVCRADVEQKIRAISV Sbjct: 117 VCFERKVDCTLVPCGHHCCCLTCAAQFEQCPVCRADVEQKIRAISV 162
BLAST of mRNA_M-pyrifera_M_contig7256.17245.1 vs. uniprot
Match: A0A6H5KTC5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KTC5_9PHAE) HSP 1 Score: 101 bits (251), Expect = 8.330e-24 Identity = 45/46 (97.83%), Postives = 45/46 (97.83%), Query Frame = 1 Query: 1 VCFERKVDCTLVPCGHHCCCLICAAQFEQCPVCRADVEQKIRAISV 138 VCFERKVDCTLVPCGHHCCCL CAAQFEQCPVCRADVEQKIRAISV Sbjct: 633 VCFERKVDCTLVPCGHHCCCLTCAAQFEQCPVCRADVEQKIRAISV 678
BLAST of mRNA_M-pyrifera_M_contig7256.17245.1 vs. uniprot
Match: D7FYF6_ECTSI (RING-type domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FYF6_ECTSI) HSP 1 Score: 74.3 bits (181), Expect = 8.700e-16 Identity = 29/44 (65.91%), Postives = 35/44 (79.55%), Query Frame = 1 Query: 1 VCFERKVDCTLVPCGHHCCCLICAAQFEQCPVCRADVEQKIRAI 132 VCF+ +VDCTLVPCGHHCCC+ CA++F CPVCR V KI+ I Sbjct: 40 VCFDNEVDCTLVPCGHHCCCITCASKFSLCPVCRTTVTHKIKTI 83
BLAST of mRNA_M-pyrifera_M_contig7256.17245.1 vs. uniprot
Match: A0A6H5KTY3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KTY3_9PHAE) HSP 1 Score: 75.5 bits (184), Expect = 9.770e-15 Identity = 30/46 (65.22%), Postives = 36/46 (78.26%), Query Frame = 1 Query: 1 VCFERKVDCTLVPCGHHCCCLICAAQFEQCPVCRADVEQKIRAISV 138 VCF+ +VDCTLVPCGHHCCC+ CA++F CPVCR V KI+ I V Sbjct: 746 VCFDNEVDCTLVPCGHHCCCITCASKFSLCPVCRTTVTHKIKTIPV 791
BLAST of mRNA_M-pyrifera_M_contig7256.17245.1 vs. uniprot
Match: A0A6H5KUU5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KUU5_9PHAE) HSP 1 Score: 67.4 bits (163), Expect = 6.870e-12 Identity = 27/46 (58.70%), Postives = 36/46 (78.26%), Query Frame = 1 Query: 1 VCFERKVDCTLVPCGHHCCCLICA-AQFEQCPVCRADVEQKIRAIS 135 VCF+R V+CT +PCGHHCCC+ CA + F CPVCR +++KI+ IS Sbjct: 927 VCFDRPVNCTFMPCGHHCCCMPCAESMFNLCPVCRVAIDKKIKTIS 972
BLAST of mRNA_M-pyrifera_M_contig7256.17245.1 vs. uniprot
Match: A0A7S3PKV0_9STRA (Hypothetical protein n=1 Tax=Aplanochytrium stocchinoi TaxID=215587 RepID=A0A7S3PKV0_9STRA) HSP 1 Score: 64.3 bits (155), Expect = 8.370e-11 Identity = 26/42 (61.90%), Postives = 31/42 (73.81%), Query Frame = 1 Query: 1 VCFERKVDCTLVPCGHHCCCLICAAQFEQCPVCRADVEQKIR 126 VCFER +DC PCGH CC CA QF++CPVCRA VEQ ++ Sbjct: 524 VCFERTIDCVFTPCGHISCCHECADQFQECPVCRAKVEQVVK 565
BLAST of mRNA_M-pyrifera_M_contig7256.17245.1 vs. uniprot
Match: D7FYF4_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FYF4_ECTSI) HSP 1 Score: 63.9 bits (154), Expect = 1.140e-10 Identity = 26/46 (56.52%), Postives = 35/46 (76.09%), Query Frame = 1 Query: 1 VCFERKVDCTLVPCGHHCCCLICA-AQFEQCPVCRADVEQKIRAIS 135 VCF+R V+CT VPCGHHCCC+ CA ++ CPVC +++KI+ IS Sbjct: 852 VCFDRPVNCTFVPCGHHCCCMPCAESKLNLCPVCGVAIDKKIKTIS 897
BLAST of mRNA_M-pyrifera_M_contig7256.17245.1 vs. uniprot
Match: Q8VX96_PINPS (Putative RING zinc finger protein (Fragment) n=1 Tax=Pinus pinaster TaxID=71647 RepID=Q8VX96_PINPS) HSP 1 Score: 58.2 bits (139), Expect = 5.340e-10 Identity = 20/43 (46.51%), Postives = 31/43 (72.09%), Query Frame = 1 Query: 1 VCFERKVDCTLVPCGHHCCCLICAAQFEQCPVCRADVEQKIRA 129 +C E++ + VPCGH CCC C+++ +CP+CR D+EQ +RA Sbjct: 35 ICLEQEYNVVFVPCGHMCCCTSCSSRLSECPLCRGDIEQVVRA 77
BLAST of mRNA_M-pyrifera_M_contig7256.17245.1 vs. uniprot
Match: A0A8K0K8Q2_LADFU (Uncharacterized protein n=1 Tax=Ladona fulva TaxID=123851 RepID=A0A8K0K8Q2_LADFU) HSP 1 Score: 61.2 bits (147), Expect = 9.180e-10 Identity = 22/44 (50.00%), Postives = 33/44 (75.00%), Query Frame = 1 Query: 1 VCFERKVDCTLVPCGHHCCCLICAAQFEQCPVCRADVEQKIRAI 132 VC +++ + +PCGH CCC+ C+ +F +CP+CR +VEQKIR I Sbjct: 283 VCMDKECEVIFIPCGHMCCCISCSEKFTECPMCRGNVEQKIRVI 326
BLAST of mRNA_M-pyrifera_M_contig7256.17245.1 vs. uniprot
Match: A0A7R9CJV7_TIMPO (Hypothetical protein n=3 Tax=Timema TaxID=61471 RepID=A0A7R9CJV7_TIMPO) HSP 1 Score: 58.5 bits (140), Expect = 1.100e-9 Identity = 23/44 (52.27%), Postives = 29/44 (65.91%), Query Frame = 1 Query: 1 VCFERKVDCTLVPCGHHCCCLICAAQFEQCPVCRADVEQKIRAI 132 VC + + VPCGH CCC+ CA QCP+CRAD+ QK+R I Sbjct: 82 VCLDNTCEVIFVPCGHMCCCIKCAELVGQCPLCRADINQKVRVI 125 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig7256.17245.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig7256.17245.1 >prot_M-pyrifera_M_contig7256.17245.1 ID=prot_M-pyrifera_M_contig7256.17245.1|Name=mRNA_M-pyrifera_M_contig7256.17245.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=47bp VCFERKVDCTLVPCGHHCCCLICAAQFEQCPVCRADVEQKIRAISV*back to top mRNA from alignment at M-pyrifera_M_contig7256:5465..5605+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig7256.17245.1 ID=mRNA_M-pyrifera_M_contig7256.17245.1|Name=mRNA_M-pyrifera_M_contig7256.17245.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=141bp|location=Sequence derived from alignment at M-pyrifera_M_contig7256:5465..5605+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig7256:5465..5605+ >mRNA_M-pyrifera_M_contig7256.17245.1 ID=mRNA_M-pyrifera_M_contig7256.17245.1|Name=mRNA_M-pyrifera_M_contig7256.17245.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=282bp|location=Sequence derived from alignment at M-pyrifera_M_contig7256:5465..5605+ (Macrocystis pyrifera P11B4 male)back to top |