mRNA_M-pyrifera_M_contig107084.1522.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig107084.1522.1 vs. uniprot
Match: UPI001459016D (putative ankyrin repeat protein RF_0381 n=1 Tax=Pecten maximus TaxID=6579 RepID=UPI001459016D) HSP 1 Score: 55.5 bits (132), Expect = 6.290e-6 Identity = 48/143 (33.57%), Postives = 67/143 (46.85%), Query Frame = 1 Query: 1 PLSSACKRGNLDVARALLDAGAHLV-------PSCLLCAVESGSIECIDLLFEHGADFND-----LRPLAEE-VGVGLLSVAFLVRKLLELGADPSERD-RYGCIPLHYAG--RNLVITKLLLSAAHDGCDVNVVDHFGRSAL 381 PL R D+A+ LL AH V S + CAVESGS+E ++L+ HGAD N + PL G G+ L R LL+ GAD +D R L +A +N + + L++A G D N D+ + L Sbjct: 80 PLMYCMVRHFCDIAKELLSRDAHAVHSQDRFGKSVIHCAVESGSVELLNLVLSHGADVNQTDWYGITPLMTLCAGTGIRHTTELCRVLLDAGADLELKDVRSKRTALQFAAVQKNTDLVQCLVAA---GADPNTTDNASLTPL 219 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig107084.1522.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig107084.1522.1 >prot_M-pyrifera_M_contig107084.1522.1 ID=prot_M-pyrifera_M_contig107084.1522.1|Name=mRNA_M-pyrifera_M_contig107084.1522.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=167bp PLSSACKRGNLDVARALLDAGAHLVPSCLLCAVESGSIECIDLLFEHGADback to top mRNA from alignment at M-pyrifera_M_contig107084:6..611+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig107084.1522.1 ID=mRNA_M-pyrifera_M_contig107084.1522.1|Name=mRNA_M-pyrifera_M_contig107084.1522.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=606bp|location=Sequence derived from alignment at M-pyrifera_M_contig107084:6..611+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig107084:6..611+ >mRNA_M-pyrifera_M_contig107084.1522.1 ID=mRNA_M-pyrifera_M_contig107084.1522.1|Name=mRNA_M-pyrifera_M_contig107084.1522.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=1002bp|location=Sequence derived from alignment at M-pyrifera_M_contig107084:6..611+ (Macrocystis pyrifera P11B4 male)back to top |