mRNA_M-pyrifera_M_contig105879.1252.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig105879.1252.1 vs. uniprot
Match: A0A3D2IAM2_9BACT (Uncharacterized protein n=3 Tax=Bacteroidetes/Chlorobi group TaxID=68336 RepID=A0A3D2IAM2_9BACT) HSP 1 Score: 62.8 bits (151), Expect = 1.150e-9 Identity = 39/108 (36.11%), Postives = 60/108 (55.56%), Query Frame = 1 Query: 1 NNLRPFLKDNPEAIAELDKMKSKRTATVVGGVIAVLGLGVALANGPTKPTGETTFDPSSGGLTDKEELTQGGAVGLGIMAVGAIVALATGPAAGKHANRAIKIHNKDL 324 +NLR +KDNPEA+ +++ K+ V G V+A G G+ L + TG+ TFDP + DK L G +G+G+ G IVA+ G +A K+ A++ +N L Sbjct: 77 DNLREEVKDNPEALEQMNIFAKKKKNLVAGYVVA--GSGIVLTAFGLEKTGQQTFDPRTNQYQDKYGLKPIGIMGMGMAFTGIIVAIVNGSSATKYIENAVEAYNNGL 182 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig105879.1252.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig105879.1252.1 >prot_M-pyrifera_M_contig105879.1252.1 ID=prot_M-pyrifera_M_contig105879.1252.1|Name=mRNA_M-pyrifera_M_contig105879.1252.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=108bp NNLRPFLKDNPEAIAELDKMKSKRTATVVGGVIAVLGLGVALANGPTKPTback to top mRNA from alignment at M-pyrifera_M_contig105879:308..631- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig105879.1252.1 ID=mRNA_M-pyrifera_M_contig105879.1252.1|Name=mRNA_M-pyrifera_M_contig105879.1252.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=324bp|location=Sequence derived from alignment at M-pyrifera_M_contig105879:308..631- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig105879:308..631- >mRNA_M-pyrifera_M_contig105879.1252.1 ID=mRNA_M-pyrifera_M_contig105879.1252.1|Name=mRNA_M-pyrifera_M_contig105879.1252.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=648bp|location=Sequence derived from alignment at M-pyrifera_M_contig105879:308..631- (Macrocystis pyrifera P11B4 male)back to top |