mRNA_M-pyrifera_M_contig105792.1239.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig105792.1239.1 vs. uniprot
Match: A0A7K3Z860_9CREN (Uncharacterized protein n=1 Tax=Crenarchaeota archaeon TaxID=2056631 RepID=A0A7K3Z860_9CREN) HSP 1 Score: 55.1 bits (131), Expect = 4.620e-6 Identity = 35/131 (26.72%), Postives = 70/131 (53.44%), Query Frame = 1 Query: 67 AQISQDFFDKRLDWDEWEIHISGEKKF----EIINGLDDALIVELKSNRPNFLRNNIDNFHLLDFDRDGDKDIIYYGFAGSESYRTLFFKNMKGSYFRLLDLFGQVVEFSYDLPTDPLSFRLLEVACCGDN 447 AQ S FF+K ++ W + + ++ ++IN + L++ ++ + L + FHL+DF+ DG +D+I+ G G+++Y LF K + +Y LL+ G++++ + +PL+ + CCG Sbjct: 20 AQPSFFFFNKEIN--NWYLDVKQQEILTEIQKVINSNEINLLLTQHQSKTDSL---MPYFHLIDFNNDGLRDLIFNGKIGTKNYVLLFKKRIDATYNLLLNQAGEILQTNAPFQNNPLALTIWNNNCCGSK 145 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig105792.1239.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig105792.1239.1 >prot_M-pyrifera_M_contig105792.1239.1 ID=prot_M-pyrifera_M_contig105792.1239.1|Name=mRNA_M-pyrifera_M_contig105792.1239.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=147bp MKLHVLLYLFLINFSVLQAQISQDFFDKRLDWDEWEIHISGEKKFEIINGback to top mRNA from alignment at M-pyrifera_M_contig105792:2..454- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig105792.1239.1 ID=mRNA_M-pyrifera_M_contig105792.1239.1|Name=mRNA_M-pyrifera_M_contig105792.1239.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=453bp|location=Sequence derived from alignment at M-pyrifera_M_contig105792:2..454- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig105792:2..454- >mRNA_M-pyrifera_M_contig105792.1239.1 ID=mRNA_M-pyrifera_M_contig105792.1239.1|Name=mRNA_M-pyrifera_M_contig105792.1239.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=882bp|location=Sequence derived from alignment at M-pyrifera_M_contig105792:2..454- (Macrocystis pyrifera P11B4 male)back to top |