mRNA_M-pyrifera_M_contig105685.1221.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig105685.1221.1 vs. uniprot
Match: A0A533TNG2_CHLSQ (Sel1 repeat family protein n=1 Tax=Chlorobium sp. TaxID=1095 RepID=A0A533TNG2_CHLSQ) HSP 1 Score: 52.0 bits (123), Expect = 9.790e-6 Identity = 29/57 (50.88%), Postives = 40/57 (70.18%), Query Frame = 1 Query: 13 AANGDADAQSAVGSFYSN----TEREAIAIKWFRLAADQGNAESQFKLAMAYDQGRG 171 A +G+A AQ+ +G Y T+ EA A+KW+RLAA+QG AE+QF LA Y++GRG Sbjct: 34 AEHGNAVAQNKLGIHYELGLGITQDEAAAVKWYRLAAEQGLAEAQFNLAEMYEEGRG 90 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig105685.1221.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig105685.1221.1 >prot_M-pyrifera_M_contig105685.1221.1 ID=prot_M-pyrifera_M_contig105685.1221.1|Name=mRNA_M-pyrifera_M_contig105685.1221.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=146bp KVSAAANGDADAQSAVGSFYSNTEREAIAIKWFRLAADQGNAESQFKLAMback to top mRNA from alignment at M-pyrifera_M_contig105685:61..498- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig105685.1221.1 ID=mRNA_M-pyrifera_M_contig105685.1221.1|Name=mRNA_M-pyrifera_M_contig105685.1221.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=438bp|location=Sequence derived from alignment at M-pyrifera_M_contig105685:61..498- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig105685:61..498- >mRNA_M-pyrifera_M_contig105685.1221.1 ID=mRNA_M-pyrifera_M_contig105685.1221.1|Name=mRNA_M-pyrifera_M_contig105685.1221.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=876bp|location=Sequence derived from alignment at M-pyrifera_M_contig105685:61..498- (Macrocystis pyrifera P11B4 male)back to top |