mRNA_M-pyrifera_M_contig105658.1210.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig105658.1210.1 vs. uniprot
Match: A0A8J4Q2C5_9MYCE (HMA domain-containing protein n=1 Tax=Polysphondylium violaceum TaxID=133409 RepID=A0A8J4Q2C5_9MYCE) HSP 1 Score: 60.8 bits (146), Expect = 3.750e-8 Identity = 28/65 (43.08%), Postives = 47/65 (72.31%), Query Frame = 1 Query: 52 KTITLYISGMTNDNHRKQLETALLRVRGVVSFLIDLYAQKAVIRTLVSAETLVRAIRDTTGMTAS 246 KT ++ GM N++ +KQ+E ALL+ +GV+SF+IDL+ +A IRT +S++ + IR+ G++AS Sbjct: 162 KTFLFHVKGMNNESIKKQVEDALLKTKGVISFMIDLHTYQATIRTSLSSDEVKLVIRNNVGLSAS 226 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig105658.1210.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig105658.1210.1 >prot_M-pyrifera_M_contig105658.1210.1 ID=prot_M-pyrifera_M_contig105658.1210.1|Name=mRNA_M-pyrifera_M_contig105658.1210.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=148bp NTPSEGAKKPNRKMANAKTITLYISGMTNDNHRKQLETALLRVRGVVSFLback to top mRNA from alignment at M-pyrifera_M_contig105658:19..462- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig105658.1210.1 ID=mRNA_M-pyrifera_M_contig105658.1210.1|Name=mRNA_M-pyrifera_M_contig105658.1210.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=444bp|location=Sequence derived from alignment at M-pyrifera_M_contig105658:19..462- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig105658:19..462- >mRNA_M-pyrifera_M_contig105658.1210.1 ID=mRNA_M-pyrifera_M_contig105658.1210.1|Name=mRNA_M-pyrifera_M_contig105658.1210.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=888bp|location=Sequence derived from alignment at M-pyrifera_M_contig105658:19..462- (Macrocystis pyrifera P11B4 male)back to top |