mRNA_M-pyrifera_M_contig104437.948.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig104437.948.1 vs. uniprot
Match: UPI000C83A703 (cell wall-binding repeat-containing protein n=2 Tax=Raoultibacter timonensis TaxID=1907662 RepID=UPI000C83A703) HSP 1 Score: 53.5 bits (127), Expect = 6.400e-6 Identity = 38/118 (32.20%), Postives = 56/118 (47.46%), Query Frame = 1 Query: 4 GGGIFMEGVTEFAADDTVIEACSATQFGGGVYLSGSTA-------SFTNTNIRSNNAYNGGGVYAVRGVQLTSKVNLTDVTIADNSATSTGGGYFCDSGWLGALDL----TLSGNTAS 324 GGG+ T++ D I +AT GGGVY+S + + + ++ I N A NGGG++ + S++ L T++DN AT GGG L L SGNTA+ Sbjct: 386 GGGVTFSTFTDYEISDCTIIDNTATDEGGGVYVSSAVSGTLPTSVTIADSEISGNTATNGGGLFGGQYKTYNSQIKLEGTTVSDNVATEDGGGVHMQDATLATLHADAATVFSGNTAA 503 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig104437.948.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig104437.948.1 >prot_M-pyrifera_M_contig104437.948.1 ID=prot_M-pyrifera_M_contig104437.948.1|Name=mRNA_M-pyrifera_M_contig104437.948.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=104bp MEGVTEFAADDTVIEACSATQFGGGVYLSGSTASFTNTNIRSNNAYNGGGback to top mRNA from alignment at M-pyrifera_M_contig104437:315..644- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig104437.948.1 ID=mRNA_M-pyrifera_M_contig104437.948.1|Name=mRNA_M-pyrifera_M_contig104437.948.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=330bp|location=Sequence derived from alignment at M-pyrifera_M_contig104437:315..644- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig104437:315..644- >mRNA_M-pyrifera_M_contig104437.948.1 ID=mRNA_M-pyrifera_M_contig104437.948.1|Name=mRNA_M-pyrifera_M_contig104437.948.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=624bp|location=Sequence derived from alignment at M-pyrifera_M_contig104437:315..644- (Macrocystis pyrifera P11B4 male)back to top |