mRNA_M-pyrifera_M_contig100229.55.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig100229.55.1 vs. uniprot
Match: A0A433TMW2_ELYCH (Uncharacterized protein n=1 Tax=Elysia chlorotica TaxID=188477 RepID=A0A433TMW2_ELYCH) HSP 1 Score: 60.5 bits (145), Expect = 1.640e-9 Identity = 30/59 (50.85%), Postives = 43/59 (72.88%), Query Frame = 1 Query: 34 ELRWAISQLELGLKREDCDREQAREARRVLIVLRNPEARLIKKRFTLKNTFGDVKAAMR 210 ELRW ISQLELGL+R+D D QA E ++L +LR+P+A L+KKR +++ GD + M+ Sbjct: 16 ELRWCISQLELGLQRQDPDSRQAMETIKILKILRSPKAPLVKKRQAMRSALGDYRKKMK 74
BLAST of mRNA_M-pyrifera_M_contig100229.55.1 vs. uniprot
Match: UPI000719CEDE (UPF0488 protein C8orf33 homolog n=1 Tax=Priapulus caudatus TaxID=37621 RepID=UPI000719CEDE) HSP 1 Score: 57.0 bits (136), Expect = 3.270e-8 Identity = 30/60 (50.00%), Postives = 42/60 (70.00%), Query Frame = 1 Query: 28 EAELRWAISQLELGLKREDCDREQAREARRVLIVLRNPEARLIKKRFTLKNTFGDVKAAM 207 E EL W I QLELGL R+ D +QARE +R+L +L +P+A L+KKR +++TF D + M Sbjct: 13 ERELIWCIEQLELGLSRQKPDSKQAREGKRILKMLSDPKAPLVKKRQAMRSTFCDYRKKM 72 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig100229.55.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig100229.55.1 >prot_M-pyrifera_M_contig100229.55.1 ID=prot_M-pyrifera_M_contig100229.55.1|Name=mRNA_M-pyrifera_M_contig100229.55.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=64bp MVEAELRWAISQLELGLKREDCDREQAREARRVLIVLRNPEARLIKKRFTback to top mRNA from alignment at M-pyrifera_M_contig100229:194..406- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig100229.55.1 ID=mRNA_M-pyrifera_M_contig100229.55.1|Name=mRNA_M-pyrifera_M_contig100229.55.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=213bp|location=Sequence derived from alignment at M-pyrifera_M_contig100229:194..406- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig100229:194..406- >mRNA_M-pyrifera_M_contig100229.55.1 ID=mRNA_M-pyrifera_M_contig100229.55.1|Name=mRNA_M-pyrifera_M_contig100229.55.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=384bp|location=Sequence derived from alignment at M-pyrifera_M_contig100229:194..406- (Macrocystis pyrifera P11B4 male)back to top |