mRNA_L-elsbetiae_contig173.4829.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig173.4829.1 vs. uniprot
Match: A0A6H5K6K9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K6K9_9PHAE) HSP 1 Score: 57.4 bits (137), Expect = 1.740e-7 Identity = 36/74 (48.65%), Postives = 43/74 (58.11%), Query Frame = 3 Query: 126 GFTALHCAA-----EVPDSGAVIRVLLEAGADIEAKTTKYGFTXXXXXX----KIASRGTIHALLDGGANCIAR 320 G+TALHC V D+G +RVLLEAGAD++AKTT G +IA G I ALL+GGAN AR Sbjct: 19 GYTALHCCVCDINEPVLDNGDTVRVLLEAGADVDAKTTGDGNCATPLHYAVNRRIAPIGAIRALLEGGANVNAR 92
BLAST of mRNA_L-elsbetiae_contig173.4829.1 vs. uniprot
Match: A0A6H5L812_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L812_9PHAE) HSP 1 Score: 54.7 bits (130), Expect = 2.130e-6 Identity = 35/73 (47.95%), Postives = 43/73 (58.90%), Query Frame = 3 Query: 126 GFTALHCAAEVP----DSGAVIRVLLEAGADIEAKTTKYGFTXXXXXX---KIASRGTIHALLDGGANCIARL 323 G+ ALH AA + D+G +RVLL AGAD+ AK TK +IAS GTI ALL+GGAN AR+ Sbjct: 240 GWAALHYAASIDGPVRDNGDAVRVLLRAGADVSAKGTKDPCDTSLYLAVNRRIASDGTIRALLEGGANINARI 312 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig173.4829.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig173.4829.1 >prot_L-elsbetiae_contig173.4829.1 ID=prot_L-elsbetiae_contig173.4829.1|Name=mRNA_L-elsbetiae_contig173.4829.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=108bp GANFSIRNNGDWSPFDIAAQHHVDIVRNLLQHGSSVKACDSRVSQPCIVLback to top mRNA from alignment at L-elsbetiae_contig173:10956..11281+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig173.4829.1 ID=mRNA_L-elsbetiae_contig173.4829.1|Name=mRNA_L-elsbetiae_contig173.4829.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=326bp|location=Sequence derived from alignment at L-elsbetiae_contig173:10956..11281+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig173:10956..11281+ >mRNA_L-elsbetiae_contig173.4829.1 ID=mRNA_L-elsbetiae_contig173.4829.1|Name=mRNA_L-elsbetiae_contig173.4829.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=648bp|location=Sequence derived from alignment at L-elsbetiae_contig173:10956..11281+ (Laminarionema elsbetiae ELsaHSoW15)back to top |