mRNA_L-elsbetiae_contig17035.4716.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig17035.4716.1 vs. uniprot
Match: D8LRY6_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LRY6_ECTSI) HSP 1 Score: 58.5 bits (140), Expect = 6.800e-7 Identity = 28/46 (60.87%), Postives = 33/46 (71.74%), Query Frame = 1 Query: 85 MILFVMLWILHDPREDDSVAGPDDSSKGVAGPDGDEYWEVPAGADG 222 MILFVMLWILHDP E S G D+ S+G+A + EYWE+P ADG Sbjct: 267 MILFVMLWILHDPAEGGSSLGSDEGSQGLAAAEDPEYWEIPPEADG 312 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig17035.4716.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig17035.4716.1 >prot_L-elsbetiae_contig17035.4716.1 ID=prot_L-elsbetiae_contig17035.4716.1|Name=mRNA_L-elsbetiae_contig17035.4716.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=77bp MILFVMLWILHDPREDDSVAGPDDSSKGVAGPDGDEYWEVPAGADGYGGGback to top mRNA from alignment at L-elsbetiae_contig17035:1304..1849+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig17035.4716.1 ID=mRNA_L-elsbetiae_contig17035.4716.1|Name=mRNA_L-elsbetiae_contig17035.4716.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=546bp|location=Sequence derived from alignment at L-elsbetiae_contig17035:1304..1849+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig17035:1304..1849+ >mRNA_L-elsbetiae_contig17035.4716.1 ID=mRNA_L-elsbetiae_contig17035.4716.1|Name=mRNA_L-elsbetiae_contig17035.4716.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=462bp|location=Sequence derived from alignment at L-elsbetiae_contig17035:1304..1849+ (Laminarionema elsbetiae ELsaHSoW15)back to top |