prot_L-elsbetiae_contig16983.4675.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig16983.4675.1 vs. uniprot
Match: A0A6H5JV12_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JV12_9PHAE) HSP 1 Score: 74.3 bits (181), Expect = 3.750e-14 Identity = 40/98 (40.82%), Postives = 58/98 (59.18%), Query Frame = 0 Query: 1 MFAIPSVTKPQAFRVSRDPSDNIVRLQVQARGAEE----------YHEGYMEIMQPGPLPDLRDMPDCPRKTVDEHTIKQHRNCFAASEDRMRVILEH 88 MF+I VTKPQAF+VS+DPSD + +QVQ R +E Y GY+ +M+ PD+RD P PRK++ + T+ QHR+C + R++ H Sbjct: 36 MFSISHVTKPQAFKVSKDPSDGVATMQVQQRSYKEEWGVINRQGEYGPGYITVMKS--WPDVRDTPSHPRKSLPDATLHQHRHCIESCNARIKNACMH 131 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig16983.4675.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig16983.4675.1 ID=prot_L-elsbetiae_contig16983.4675.1|Name=mRNA_L-elsbetiae_contig16983.4675.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=113bpback to top |