mRNA_L-elsbetiae_contig16158.4232.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig16158.4232.1 vs. uniprot
Match: A0A6H5J7P3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J7P3_9PHAE) HSP 1 Score: 97.8 bits (242), Expect = 1.550e-23 Identity = 49/76 (64.47%), Postives = 56/76 (73.68%), Query Frame = 1 Query: 1 VLERQKKREGYGDNVNSVFARTVRGHLQYLPGQAIGARGVGNQCKRGACFKELIDMCAGDGDEGIPRDVVLALLRH 228 VL+RQK+R+ GDNV+ V ARTVR LQYL Q IGA G GNQC+RG CF + M G G EGIPRDVVLALLR+ Sbjct: 148 VLDRQKERDSQGDNVSYVLARTVRRILQYLAAQEIGASGQGNQCRRGDCFARAMGMFFGKGMEGIPRDVVLALLRY 223
BLAST of mRNA_L-elsbetiae_contig16158.4232.1 vs. uniprot
Match: A0A6H5KKJ8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KKJ8_9PHAE) HSP 1 Score: 52.4 bits (124), Expect = 4.080e-7 Identity = 24/66 (36.36%), Postives = 38/66 (57.58%), Query Frame = 1 Query: 31 YGDNVNSVFARTVRGHLQYLPGQAIGARGVGNQCKRGACFKELIDMCAGDGDEGIPRDVVLALLRH 228 Y D+ A+ VR + Y + +G G GNQ K G C + + AGDG++G+P +VV A+L++ Sbjct: 24 YKDDPGYCVAKRVRNQVYYDTAKDLGCFGRGNQLKAGECMRAATKVFAGDGNDGLPTEVVKAMLQY 89
BLAST of mRNA_L-elsbetiae_contig16158.4232.1 vs. uniprot
Match: A0A6H5KG83_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KG83_9PHAE) HSP 1 Score: 50.8 bits (120), Expect = 7.880e-6 Identity = 25/66 (37.88%), Postives = 36/66 (54.55%), Query Frame = 1 Query: 31 YGDNVNSVFARTVRGHLQYLPGQAIGARGVGNQCKRGACFKELIDMCAGDGDEGIPRDVVLALLRH 228 Y D+ A+ VR Y + +G G GNQ K G C + AGDG++G+P +VV A+L+H Sbjct: 115 YKDDPGYCVAKRVRNQGYYDTAKDLGCFGRGNQLKAGECMCAATKVFAGDGNDGLPTEVVKAMLQH 180 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig16158.4232.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig16158.4232.1 >prot_L-elsbetiae_contig16158.4232.1 ID=prot_L-elsbetiae_contig16158.4232.1|Name=mRNA_L-elsbetiae_contig16158.4232.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=77bp VLERQKKREGYGDNVNSVFARTVRGHLQYLPGQAIGARGVGNQCKRGACFback to top mRNA from alignment at L-elsbetiae_contig16158:2157..2387+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig16158.4232.1 ID=mRNA_L-elsbetiae_contig16158.4232.1|Name=mRNA_L-elsbetiae_contig16158.4232.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=231bp|location=Sequence derived from alignment at L-elsbetiae_contig16158:2157..2387+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig16158:2157..2387+ >mRNA_L-elsbetiae_contig16158.4232.1 ID=mRNA_L-elsbetiae_contig16158.4232.1|Name=mRNA_L-elsbetiae_contig16158.4232.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=462bp|location=Sequence derived from alignment at L-elsbetiae_contig16158:2157..2387+ (Laminarionema elsbetiae ELsaHSoW15)back to top |