mRNA_L-elsbetiae_contig16148.4225.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig16148.4225.1 vs. uniprot
Match: D7G0H8_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G0H8_ECTSI) HSP 1 Score: 108 bits (270), Expect = 1.120e-26 Identity = 53/69 (76.81%), Postives = 61/69 (88.41%), Query Frame = 1 Query: 1 SGMSPLSAAAWLGKEDCLEAILETEGGLATLDMANNLGATPLLFACQENRKSIAEKLLAAGASLDASDV 207 SG+SPLSA AWLGKE CL+AIL TE GLATL++ NNLGATPL+FACQEN K IA+KL+AAGASLDA D+ Sbjct: 201 SGLSPLSATAWLGKEACLDAILGTERGLATLELTNNLGATPLIFACQENNKDIAKKLIAAGASLDAKDL 269
BLAST of mRNA_L-elsbetiae_contig16148.4225.1 vs. uniprot
Match: A0A6H5KW25_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KW25_9PHAE) HSP 1 Score: 94.4 bits (233), Expect = 8.350e-24 Identity = 48/69 (69.57%), Postives = 56/69 (81.16%), Query Frame = 1 Query: 1 SGMSPLSAAAWLGKEDCLEAILETEGGLATLDMANNLGATPLLFACQENRKSIAEKLLAAGASLDASDV 207 SG+S +SA WLGKE CL+ IL TE GL TL++ NNLGATPL+FACQEN K IA KL+AAGASLDA D+ Sbjct: 21 SGLSSVSATTWLGKEACLDPILGTERGLTTLELTNNLGATPLIFACQENNKGIA-KLIAAGASLDAKDL 88 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig16148.4225.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig16148.4225.1 >prot_L-elsbetiae_contig16148.4225.1 ID=prot_L-elsbetiae_contig16148.4225.1|Name=mRNA_L-elsbetiae_contig16148.4225.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=68bp MSPLSAAAWLGKEDCLEAILETEGGLATLDMANNLGATPLLFACQENRKSback to top mRNA from alignment at L-elsbetiae_contig16148:504..713- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig16148.4225.1 ID=mRNA_L-elsbetiae_contig16148.4225.1|Name=mRNA_L-elsbetiae_contig16148.4225.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=210bp|location=Sequence derived from alignment at L-elsbetiae_contig16148:504..713- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig16148:504..713- >mRNA_L-elsbetiae_contig16148.4225.1 ID=mRNA_L-elsbetiae_contig16148.4225.1|Name=mRNA_L-elsbetiae_contig16148.4225.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=408bp|location=Sequence derived from alignment at L-elsbetiae_contig16148:504..713- (Laminarionema elsbetiae ELsaHSoW15)back to top |