prot_L-elsbetiae_contig1593.4097.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1593.4097.1 vs. uniprot
Match: A0A6H5JD92_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JD92_9PHAE) HSP 1 Score: 76.6 bits (187), Expect = 5.500e-14 Identity = 34/73 (46.58%), Postives = 45/73 (61.64%), Query Frame = 0 Query: 41 PVSGATETWACTVGRPSACYDQISESDYKSMVISQQR-MQCTSACLTDGGFWCQAMGIDGCRFCSLDCDEFCS 112 P SG T T CT G CYDQ+ E K +++ + R + C +CL DGG WC A+G+ GCRFC+ CD FC+ Sbjct: 1266 PTSGVTFT-ECTPGDSDTCYDQL-EPSMKGLLVERSRGLTCEESCLIDGGLWCDALGLSGCRFCATSCDNFCT 1336 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1593.4097.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig1593.4097.1 ID=prot_L-elsbetiae_contig1593.4097.1|Name=mRNA_L-elsbetiae_contig1593.4097.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=112bpback to top |