prot_L-elsbetiae_contig15713.3994.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig15713.3994.1 vs. uniprot
Match: D7FI73_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FI73_ECTSI) HSP 1 Score: 62.4 bits (150), Expect = 7.310e-7 Identity = 25/39 (64.10%), Postives = 32/39 (82.05%), Query Frame = 0 Query: 3 SKCHHVGCTKQSRYGAAGSKKKEFCSEHKKDGMVNISNK 41 S+C H CTK+ YG AGSKK+EFCS+H +DGMVN++NK Sbjct: 2 SQCGHANCTKRPTYGVAGSKKREFCSQHARDGMVNVNNK 40
BLAST of mRNA_L-elsbetiae_contig15713.3994.1 vs. uniprot
Match: A0A6H5JT00_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JT00_9PHAE) HSP 1 Score: 61.6 bits (148), Expect = 1.870e-6 Identity = 25/39 (64.10%), Postives = 32/39 (82.05%), Query Frame = 0 Query: 3 SKCHHVGCTKQSRYGAAGSKKKEFCSEHKKDGMVNISNK 41 S+C H CTK+ YG AGSKK+EFCS+H +DGMVN++NK Sbjct: 62 SQCGHENCTKRPTYGVAGSKKREFCSQHARDGMVNVNNK 100
BLAST of mRNA_L-elsbetiae_contig15713.3994.1 vs. uniprot
Match: A0A6H5KW71_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KW71_9PHAE) HSP 1 Score: 56.6 bits (135), Expect = 7.080e-5 Identity = 24/41 (58.54%), Postives = 32/41 (78.05%), Query Frame = 0 Query: 1 MPSKCHHVGCTKQSRYGAAGSKKKEFCSEHKKDGMVNISNK 41 MP+ C H GC KQ +YG AG+KK+EFCS H+K GMV++ N+ Sbjct: 1 MPA-CGHAGCPKQPKYGVAGTKKREFCSGHRKAGMVDVVNR 40 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig15713.3994.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig15713.3994.1 ID=prot_L-elsbetiae_contig15713.3994.1|Name=mRNA_L-elsbetiae_contig15713.3994.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=532bpback to top |