prot_L-elsbetiae_contig15611.3932.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig15611.3932.1 vs. uniprot
Match: A0A6H5L9L5_9PHAE (Protein kinase domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5L9L5_9PHAE) HSP 1 Score: 123 bits (308), Expect = 3.650e-31 Identity = 60/64 (93.75%), Postives = 62/64 (96.88%), Query Frame = 0 Query: 33 SSSGANSPFAVSDFLFREDLYSLGYVFLELVFGAFCESKSKRPDQNALKRLLEDIFKGDFKAFK 96 SSSGA SPFAVSDFLFREDLYSLGYVFLELVFGAFC+ KSKRPDQN+LKRLLEDIFKGDFKAFK Sbjct: 318 SSSGATSPFAVSDFLFREDLYSLGYVFLELVFGAFCDDKSKRPDQNSLKRLLEDIFKGDFKAFK 381
BLAST of mRNA_L-elsbetiae_contig15611.3932.1 vs. uniprot
Match: A0A7S3ECV9_9RHOD (Hypothetical protein n=2 Tax=Rhodosorus marinus TaxID=101924 RepID=A0A7S3ECV9_9RHOD) HSP 1 Score: 56.6 bits (135), Expect = 3.010e-7 Identity = 26/55 (47.27%), Postives = 38/55 (69.09%), Query Frame = 0 Query: 35 SGANSPFAVSDFLFREDLYSLGYVFLELVFGAFCES-KSKRPDQNALKRLLEDIF 88 SGA+SP VS + F +D+Y+LGY F+E++FG+ ES + Q A KRL ED++ Sbjct: 286 SGASSPTEVSRYFFADDIYALGYAFMEIIFGSLSESGPGPQTTQEAFKRLFEDVY 340
BLAST of mRNA_L-elsbetiae_contig15611.3932.1 vs. uniprot
Match: A0A2V3IFG9_9FLOR (Uncharacterized protein n=1 Tax=Gracilariopsis chorda TaxID=448386 RepID=A0A2V3IFG9_9FLOR) HSP 1 Score: 51.2 bits (121), Expect = 7.110e-6 Identity = 27/62 (43.55%), Postives = 38/62 (61.29%), Query Frame = 0 Query: 35 SGANSPFAVSDFLFREDLYSLGYVFLELVFGAFCESKSKRPDQNALKRLLEDIFKGDFKAFK 96 +GA +P ++ F F ED+Y+LGY FLEL+F +F Q+ K+L ED FK D AF+ Sbjct: 41 AGAVTPATIAAFHFAEDIYALGYSFLELIFSSF---SGVPVPQDRFKKLFEDTFKLDVNAFR 99 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig15611.3932.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig15611.3932.1 ID=prot_L-elsbetiae_contig15611.3932.1|Name=mRNA_L-elsbetiae_contig15611.3932.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=96bpback to top |