mRNA_L-elsbetiae_contig15611.3932.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig15611.3932.1 vs. uniprot
Match: A0A6H5L9L5_9PHAE (Protein kinase domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5L9L5_9PHAE) HSP 1 Score: 123 bits (308), Expect = 1.870e-29 Identity = 60/64 (93.75%), Postives = 62/64 (96.88%), Query Frame = 2 Query: 428 SSSGANSPFAVSDFLFREDLYSLGYVFLELVFGAFCESKSKRPDQNALKRLLEDIFKGDFKAFK 619 SSSGA SPFAVSDFLFREDLYSLGYVFLELVFGAFC+ KSKRPDQN+LKRLLEDIFKGDFKAFK Sbjct: 318 SSSGATSPFAVSDFLFREDLYSLGYVFLELVFGAFCDDKSKRPDQNSLKRLLEDIFKGDFKAFK 381
BLAST of mRNA_L-elsbetiae_contig15611.3932.1 vs. uniprot
Match: A0A7S3ECV9_9RHOD (Hypothetical protein n=2 Tax=Rhodosorus marinus TaxID=101924 RepID=A0A7S3ECV9_9RHOD) HSP 1 Score: 56.6 bits (135), Expect = 5.590e-6 Identity = 26/55 (47.27%), Postives = 38/55 (69.09%), Query Frame = 2 Query: 434 SGANSPFAVSDFLFREDLYSLGYVFLELVFGAFCES-KSKRPDQNALKRLLEDIF 595 SGA+SP VS + F +D+Y+LGY F+E++FG+ ES + Q A KRL ED++ Sbjct: 286 SGASSPTEVSRYFFADDIYALGYAFMEIIFGSLSESGPGPQTTQEAFKRLFEDVY 340
BLAST of mRNA_L-elsbetiae_contig15611.3932.1 vs. uniprot
Match: A0A2V3IFG9_9FLOR (Uncharacterized protein n=1 Tax=Gracilariopsis chorda TaxID=448386 RepID=A0A2V3IFG9_9FLOR) HSP 1 Score: 51.2 bits (121), Expect = 8.650e-5 Identity = 27/62 (43.55%), Postives = 38/62 (61.29%), Query Frame = 2 Query: 434 SGANSPFAVSDFLFREDLYSLGYVFLELVFGAFCESKSKRPDQNALKRLLEDIFKGDFKAFK 619 +GA +P ++ F F ED+Y+LGY FLEL+F +F Q+ K+L ED FK D AF+ Sbjct: 41 AGAVTPATIAAFHFAEDIYALGYSFLELIFSSF---SGVPVPQDRFKKLFEDTFKLDVNAFR 99 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig15611.3932.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig15611.3932.1 >prot_L-elsbetiae_contig15611.3932.1 ID=prot_L-elsbetiae_contig15611.3932.1|Name=mRNA_L-elsbetiae_contig15611.3932.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=96bp MSSVVTATANCHRPPPRNPPTTLSTAAAATRASSSGANSPFAVSDFLFREback to top mRNA from alignment at L-elsbetiae_contig15611:2597..3215+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig15611.3932.1 ID=mRNA_L-elsbetiae_contig15611.3932.1|Name=mRNA_L-elsbetiae_contig15611.3932.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=619bp|location=Sequence derived from alignment at L-elsbetiae_contig15611:2597..3215+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig15611:2597..3215+ >mRNA_L-elsbetiae_contig15611.3932.1 ID=mRNA_L-elsbetiae_contig15611.3932.1|Name=mRNA_L-elsbetiae_contig15611.3932.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=576bp|location=Sequence derived from alignment at L-elsbetiae_contig15611:2597..3215+ (Laminarionema elsbetiae ELsaHSoW15)back to top |