prot_L-elsbetiae_contig1485.3505.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1485.3505.1 vs. uniprot
Match: D7G626_ECTSI (Hypothetical leucine rich repeat protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G626_ECTSI) HSP 1 Score: 92.0 bits (227), Expect = 5.580e-20 Identity = 48/77 (62.34%), Postives = 55/77 (71.43%), Query Frame = 0 Query: 1 MSRFLEYGVFVPDPKKEGSAPEPSSSLSATQTGQWAQVGGKWLKVGPDGQPLVPPPRS-FSQTMPASSGNGGXGGAE 76 MSRFLEYGVFVPDP S+ S+ S T TGQWAQVGGKW KVGPDG+PL P +S FSQ+ P + G GG GG + Sbjct: 1 MSRFLEYGVFVPDP----SSKHGSTQSSQTATGQWAQVGGKWCKVGPDGKPLNAPSKSSFSQSSPINMGGGGEGGVD 73 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1485.3505.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig1485.3505.1 ID=prot_L-elsbetiae_contig1485.3505.1|Name=mRNA_L-elsbetiae_contig1485.3505.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=78bpback to top |