mRNA_L-elsbetiae_contig1485.3505.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1485.3505.1 vs. uniprot
Match: D7G626_ECTSI (Hypothetical leucine rich repeat protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G626_ECTSI) HSP 1 Score: 92.4 bits (228), Expect = 8.910e-19 Identity = 48/77 (62.34%), Postives = 55/77 (71.43%), Query Frame = 2 Query: 251 MSRFLEYGVFVPDPKKEGSAPEPSSSLSATQTGQWAQVGGKWLKVGPDGQPLVPPPRS-FSQTMPASSGNGGXGGAE 478 MSRFLEYGVFVPDP S+ S+ S T TGQWAQVGGKW KVGPDG+PL P +S FSQ+ P + G GG GG + Sbjct: 1 MSRFLEYGVFVPDP----SSKHGSTQSSQTATGQWAQVGGKWCKVGPDGKPLNAPSKSSFSQSSPINMGGGGEGGVD 73 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1485.3505.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig1485.3505.1 >prot_L-elsbetiae_contig1485.3505.1 ID=prot_L-elsbetiae_contig1485.3505.1|Name=mRNA_L-elsbetiae_contig1485.3505.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=78bp MSRFLEYGVFVPDPKKEGSAPEPSSSLSATQTGQWAQVGGKWLKVGPDGQback to top mRNA from alignment at L-elsbetiae_contig1485:21178..22184+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig1485.3505.1 ID=mRNA_L-elsbetiae_contig1485.3505.1|Name=mRNA_L-elsbetiae_contig1485.3505.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=1007bp|location=Sequence derived from alignment at L-elsbetiae_contig1485:21178..22184+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig1485:21178..22184+ >mRNA_L-elsbetiae_contig1485.3505.1 ID=mRNA_L-elsbetiae_contig1485.3505.1|Name=mRNA_L-elsbetiae_contig1485.3505.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=468bp|location=Sequence derived from alignment at L-elsbetiae_contig1485:21178..22184+ (Laminarionema elsbetiae ELsaHSoW15)back to top |