prot_L-elsbetiae_contig14725.3434.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig14725.3434.1 vs. uniprot
Match: A0A6H5JH57_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JH57_9PHAE) HSP 1 Score: 52.0 bits (123), Expect = 2.740e-6 Identity = 26/38 (68.42%), Postives = 29/38 (76.32%), Query Frame = 0 Query: 20 HLSNLAVSADQRRQMEEDYRLALTMQRGGVAGAAGDRG 57 HL N AV+AD+RRQMEEDYRLAL MQ+G A A G G Sbjct: 28 HLRNFAVTADERRQMEEDYRLALAMQKGEAAAANGTGG 65
BLAST of mRNA_L-elsbetiae_contig14725.3434.1 vs. uniprot
Match: D8LDG4_ECTSI (FYVE-type domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LDG4_ECTSI) HSP 1 Score: 50.1 bits (118), Expect = 1.560e-5 Identity = 25/35 (71.43%), Postives = 28/35 (80.00%), Query Frame = 0 Query: 20 HLSNLAVSADQRRQMEEDYRLALTMQRGGVAGAAG 54 HL N AV+AD+RRQMEEDYRLAL MQ+G A A G Sbjct: 378 HLRNFAVTADERRQMEEDYRLALAMQKGEAAVANG 412 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig14725.3434.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig14725.3434.1 ID=prot_L-elsbetiae_contig14725.3434.1|Name=mRNA_L-elsbetiae_contig14725.3434.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=60bpback to top |