mRNA_L-elsbetiae_contig14396.3240.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig14396.3240.1 vs. uniprot
Match: A0A6H5KY84_9PHAE (Integrase catalytic domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KY84_9PHAE) HSP 1 Score: 53.9 bits (128), Expect = 9.080e-6 Identity = 24/48 (50.00%), Postives = 32/48 (66.67%), Query Frame = 1 Query: 1 SIGMKEGTDPDTFLAEVQDLANKLEYLGDGVSDARLADIVLQGLPPSY 144 S M+ GTDPD F+ V LA +L ++G V+D +L DI+LQGLP Y Sbjct: 260 SATMRTGTDPDIFITHVWHLAEQLRFIGGTVTDEKLGDIILQGLPAEY 307 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig14396.3240.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig14396.3240.1 >prot_L-elsbetiae_contig14396.3240.1 ID=prot_L-elsbetiae_contig14396.3240.1|Name=mRNA_L-elsbetiae_contig14396.3240.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=127bp MKEGTDPDTFLAEVQDLANKLEYLGDGVSDARLADIVLQGLPPSYDQLRLback to top mRNA from alignment at L-elsbetiae_contig14396:69..458+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig14396.3240.1 ID=mRNA_L-elsbetiae_contig14396.3240.1|Name=mRNA_L-elsbetiae_contig14396.3240.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=390bp|location=Sequence derived from alignment at L-elsbetiae_contig14396:69..458+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig14396:69..458+ >mRNA_L-elsbetiae_contig14396.3240.1 ID=mRNA_L-elsbetiae_contig14396.3240.1|Name=mRNA_L-elsbetiae_contig14396.3240.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=762bp|location=Sequence derived from alignment at L-elsbetiae_contig14396:69..458+ (Laminarionema elsbetiae ELsaHSoW15)back to top |