prot_L-elsbetiae_contig14388.3236.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig14388.3236.1 vs. uniprot
Match: D8LAX7_ECTSI (Cell wall surface anchor family protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LAX7_ECTSI) HSP 1 Score: 85.1 bits (209), Expect = 4.700e-20 Identity = 37/40 (92.50%), Postives = 38/40 (95.00%), Query Frame = 0 Query: 2 AWVRLLERAPWSGRDGHAALAHNGAIFLMGGTQDPRSNFS 41 AWVRLLE APWSGRDGHAAL HNGAIFLMGGTQDPR+NFS Sbjct: 66 AWVRLLEHAPWSGRDGHAALTHNGAIFLMGGTQDPRNNFS 105
BLAST of mRNA_L-elsbetiae_contig14388.3236.1 vs. uniprot
Match: A0A6H5JNX3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JNX3_9PHAE) HSP 1 Score: 81.3 bits (199), Expect = 1.130e-16 Identity = 35/38 (92.11%), Postives = 36/38 (94.74%), Query Frame = 0 Query: 2 AWVRLLERAPWSGRDGHAALAHNGAIFLMGGTQDPRSN 39 AWVRLLE APWSGRDGHAAL HNGAIFLMGGTQDPR+N Sbjct: 66 AWVRLLEHAPWSGRDGHAALTHNGAIFLMGGTQDPRNN 103
BLAST of mRNA_L-elsbetiae_contig14388.3236.1 vs. uniprot
Match: A0A835YGT5_9STRA (Cell wall surface anchor family protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YGT5_9STRA) HSP 1 Score: 61.6 bits (148), Expect = 6.230e-11 Identity = 25/37 (67.57%), Postives = 30/37 (81.08%), Query Frame = 0 Query: 3 WVRLLERAPWSGRDGHAALAHNGAIFLMGGTQDPRSN 39 W ++ RAPWSGRDGH AL H G+I++MGGTQD RSN Sbjct: 57 WSQITPRAPWSGRDGHVALEHLGSIYIMGGTQDLRSN 93
BLAST of mRNA_L-elsbetiae_contig14388.3236.1 vs. uniprot
Match: A0A5S9NUV9_9GAMM (N-acetylneuraminate epimerase n=1 Tax=BD1-7 clade bacterium TaxID=2029982 RepID=A0A5S9NUV9_9GAMM) HSP 1 Score: 48.5 bits (114), Expect = 3.930e-5 Identity = 21/53 (39.62%), Postives = 31/53 (58.49%), Query Frame = 0 Query: 1 QAWVRLL-ERAPWSGRDGHAALAHNGAIFLMGGTQDPRSNFSDVWRSANGRDW 52 + W ++ E W R +A +H G I+LMGG D R+ F D+WRS +G+ W Sbjct: 278 KTWQQITTEGRQWLARKALSAASHLGYIYLMGGENDARNAFDDLWRSIDGKKW 330
BLAST of mRNA_L-elsbetiae_contig14388.3236.1 vs. uniprot
Match: A0A5S9P204_9GAMM (N-acetylneuraminate epimerase n=1 Tax=BD1-7 clade bacterium TaxID=2029982 RepID=A0A5S9P204_9GAMM) HSP 1 Score: 48.1 bits (113), Expect = 5.380e-5 Identity = 21/53 (39.62%), Postives = 31/53 (58.49%), Query Frame = 0 Query: 1 QAWVRLL-ERAPWSGRDGHAALAHNGAIFLMGGTQDPRSNFSDVWRSANGRDW 52 + W ++ E W R +A +H G I+LMGG D R+ F D+WRS +G+ W Sbjct: 278 KTWQQVTTEGRQWLARKALSAASHLGYIYLMGGENDARNAFDDLWRSIDGKKW 330 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig14388.3236.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 5
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig14388.3236.1 ID=prot_L-elsbetiae_contig14388.3236.1|Name=mRNA_L-elsbetiae_contig14388.3236.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=52bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|