prot_L-elsbetiae_contig1407.3039.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1407.3039.1 vs. uniprot
Match: A0A6H5KNP1_9PHAE (MULE domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KNP1_9PHAE) HSP 1 Score: 53.9 bits (128), Expect = 5.380e-7 Identity = 31/65 (47.69%), Postives = 36/65 (55.38%), Query Frame = 0 Query: 2 KNMAKSASQAAVAESYQHLASYAAQLQKECPGSVAEVEQHPDGTFKRYGFMLGRAAFACAESPLK 66 K A A QAA A S Q Y +L K PGSVA VE+HPDG+FKR ++ RAA A K Sbjct: 27 KKNAVDALQAAAAGSIQQAPGYCRELVKMSPGSVANVERHPDGSFKRIAIVVNRAALVIARGLFK 91 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1407.3039.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig1407.3039.1 ID=prot_L-elsbetiae_contig1407.3039.1|Name=mRNA_L-elsbetiae_contig1407.3039.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=68bpback to top |