prot_L-elsbetiae_contig10254.298.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig10254.298.1 vs. uniprot
Match: A0A6H5JH57_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JH57_9PHAE) HSP 1 Score: 49.7 bits (117), Expect = 6.570e-5 Identity = 40/95 (42.11%), Postives = 50/95 (52.63%), Query Frame = 0 Query: 1 MRNLTMSADDERRQMEEDNRLAPAMQKGEAADTVGARGLSAEAMIPAELVPEATS-SPPFSHVPMEDRNGGXXXXXXXXXXXXXGGWRASSGSKG 94 +RN ++AD ERRQMEED RLA AMQKGEAA G G P + P +++ S FS + +R+G WR SSGSKG Sbjct: 29 LRNFAVTAD-ERRQMEEDYRLALAMQKGEAAAANGTGGRGVPVAAPVQAPPASSAGSSSFSRMLGNERDGNSGGAGGGGI------WRRSSGSKG 116 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig10254.298.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig10254.298.1 ID=prot_L-elsbetiae_contig10254.298.1|Name=mRNA_L-elsbetiae_contig10254.298.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=94bpback to top |