mRNA_L-elsbetiae_contig13405.2623.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig13405.2623.1 vs. uniprot
Match: A0A6H5J9J6_9PHAE (S4 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J9J6_9PHAE) HSP 1 Score: 58.2 bits (139), Expect = 2.250e-7 Identity = 32/47 (68.09%), Postives = 36/47 (76.60%), Query Frame = -2 Query: 156 LARSGMASRRAAGRLVEAGVATVNGTPVQTPALNVGLRYMVKVKFRL 296 +ARSG+ASRR A R+VEAGV VNG VQTPALNVG R +VKV L Sbjct: 119 IARSGIASRREAERMVEAGVVMVNGATVQTPALNVGPRDIVKVNVGL 165
BLAST of mRNA_L-elsbetiae_contig13405.2623.1 vs. uniprot
Match: D8LDE8_ECTSI (RNA pseudouridylate synthase domain-containing protein (C-terminal) RNA pseudouridylate synthase dom n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LDE8_ECTSI) HSP 1 Score: 58.2 bits (139), Expect = 2.820e-7 Identity = 32/47 (68.09%), Postives = 36/47 (76.60%), Query Frame = -2 Query: 156 LARSGMASRRAAGRLVEAGVATVNGTPVQTPALNVGLRYMVKVKFRL 296 +ARSG+ASRR A R+VEAGV VNG VQTPALNVG R +VKV L Sbjct: 119 IARSGIASRREAERMVEAGVVMVNGATVQTPALNVGPRDIVKVNVGL 165 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig13405.2623.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig13405.2623.1 >prot_L-elsbetiae_contig13405.2623.1 ID=prot_L-elsbetiae_contig13405.2623.1|Name=mRNA_L-elsbetiae_contig13405.2623.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=130bp MLKPFTVHIGFISLINRSILIQSDWAHTTERSAGPPRTLLCLNQNDNKEPback to top mRNA from alignment at L-elsbetiae_contig13405:2363..2758+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig13405.2623.1 ID=mRNA_L-elsbetiae_contig13405.2623.1|Name=mRNA_L-elsbetiae_contig13405.2623.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=396bp|location=Sequence derived from alignment at L-elsbetiae_contig13405:2363..2758+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig13405:2363..2758+ >mRNA_L-elsbetiae_contig13405.2623.1 ID=mRNA_L-elsbetiae_contig13405.2623.1|Name=mRNA_L-elsbetiae_contig13405.2623.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=780bp|location=Sequence derived from alignment at L-elsbetiae_contig13405:2363..2758+ (Laminarionema elsbetiae ELsaHSoW15)back to top |