prot_L-elsbetiae_contig13179.2486.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig13179.2486.1 vs. uniprot
Match: A0A6H5K4M0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K4M0_9PHAE) HSP 1 Score: 54.7 bits (130), Expect = 7.020e-5 Identity = 26/51 (50.98%), Postives = 37/51 (72.55%), Query Frame = 0 Query: 1 MDVLVQSAAVELWKWSEFVQLRGVVSACSLESVTW-PTGLEELVLDADLDV 50 M+ L+++AA+ELW WSE ++L+G + A SL S W P L +LVL ADLD+ Sbjct: 1125 MESLLRTAAIELWTWSECLELQGSLCAASLRSANWWPRRLTQLVLKADLDI 1175 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig13179.2486.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig13179.2486.1 ID=prot_L-elsbetiae_contig13179.2486.1|Name=mRNA_L-elsbetiae_contig13179.2486.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=249bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|