mRNA_L-elsbetiae_contig13170.2483.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig13170.2483.1 vs. uniprot
Match: A0A6H5L089_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L089_9PHAE) HSP 1 Score: 60.8 bits (146), Expect = 7.010e-9 Identity = 27/76 (35.53%), Postives = 47/76 (61.84%), Query Frame = 1 Query: 1 WGILRDWVLPSTVPQKRLLRAQLHSVECPVGSHPHTYFAAFDRICNMLKEVGDKIGEQEKLQAMIEQLPEEYAIQK 228 W +R+W LP+T ++RLL QL +VE G +P +FA D I N ++ VG + E++ +Q ++ QL +Y +++ Sbjct: 474 WTAIREWSLPTTDAEQRLLERQLETVEMSPGENPKLFFARVDGIVNTMRAVGIEKSERQIVQTIVRQLSSDYDVER 549 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig13170.2483.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig13170.2483.1 >prot_L-elsbetiae_contig13170.2483.1 ID=prot_L-elsbetiae_contig13170.2483.1|Name=mRNA_L-elsbetiae_contig13170.2483.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=86bp WGILRDWVLPSTVPQKRLLRAQLHSVECPVGSHPHTYFAAFDRICNMLKEback to top mRNA from alignment at L-elsbetiae_contig13170:3672..3929+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig13170.2483.1 ID=mRNA_L-elsbetiae_contig13170.2483.1|Name=mRNA_L-elsbetiae_contig13170.2483.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=258bp|location=Sequence derived from alignment at L-elsbetiae_contig13170:3672..3929+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig13170:3672..3929+ >mRNA_L-elsbetiae_contig13170.2483.1 ID=mRNA_L-elsbetiae_contig13170.2483.1|Name=mRNA_L-elsbetiae_contig13170.2483.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=516bp|location=Sequence derived from alignment at L-elsbetiae_contig13170:3672..3929+ (Laminarionema elsbetiae ELsaHSoW15)back to top |