prot_L-elsbetiae_contig987.18811.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig987.18811.1 vs. uniprot
Match: A0A6H5K8L6_9PHAE (Zn(2)-C6 fungal-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K8L6_9PHAE) HSP 1 Score: 78.6 bits (192), Expect = 5.350e-12 Identity = 47/111 (42.34%), Postives = 59/111 (53.15%), Query Frame = 0 Query: 8 PEVHGGVGELCFWGIMDYACSLQGQTYSTAVCGVSRCADIFVKNPGLCRFTSWKHLAHCCLAYLALSGSPDKYEELRASYNSVVDNGDRKAPPLEAFRGMNCICGNTFCKS 118 PEV G+G L F I Y G T A V CA IFV+ PGLCRF+ W+HL+HC L LA + +EELR YNSV + P +A+ M C + FC+S Sbjct: 442 PEVGVGIGGLIFNAISAYLDISTGSTKLGAE-KVKLCAKIFVRYPGLCRFSRWQHLSHCLLTVLATLEDAEPFEELRQVYNSVRTEDLVEVPEQQAWT-MVGFCNHIFCRS 550 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig987.18811.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig987.18811.1 ID=prot_L-elsbetiae_contig987.18811.1|Name=mRNA_L-elsbetiae_contig987.18811.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=397bpback to top |