mRNA_L-elsbetiae_contig987.18811.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig987.18811.1 vs. uniprot
Match: A0A6H5K8L6_9PHAE (Zn(2)-C6 fungal-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K8L6_9PHAE) HSP 1 Score: 78.6 bits (192), Expect = 2.710e-11 Identity = 47/111 (42.34%), Postives = 59/111 (53.15%), Query Frame = 3 Query: 60 PEVHGGVGELCFWGIMDYACSLQGQTYSTAVCGVSRCADIFVKNPGLCRFTSWKHLAHCCLAYLALSGSPDKYEELRASYNSVVDNGDRKAPPLEAFRGMNCICGNTFCKS 392 PEV G+G L F I Y G T A V CA IFV+ PGLCRF+ W+HL+HC L LA + +EELR YNSV + P +A+ M C + FC+S Sbjct: 442 PEVGVGIGGLIFNAISAYLDISTGSTKLGAE-KVKLCAKIFVRYPGLCRFSRWQHLSHCLLTVLATLEDAEPFEELRQVYNSVRTEDLVEVPEQQAWT-MVGFCNHIFCRS 550 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig987.18811.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig987.18811.1 >prot_L-elsbetiae_contig987.18811.1 ID=prot_L-elsbetiae_contig987.18811.1|Name=mRNA_L-elsbetiae_contig987.18811.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=397bp MVHVTQCPEVHGGVGELCFWGIMDYACSLQGQTYSTAVCGVSRCADIFVKback to top mRNA from alignment at L-elsbetiae_contig987:18137..22623- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig987.18811.1 ID=mRNA_L-elsbetiae_contig987.18811.1|Name=mRNA_L-elsbetiae_contig987.18811.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=4487bp|location=Sequence derived from alignment at L-elsbetiae_contig987:18137..22623- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig987:18137..22623- >mRNA_L-elsbetiae_contig987.18811.1 ID=mRNA_L-elsbetiae_contig987.18811.1|Name=mRNA_L-elsbetiae_contig987.18811.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=2382bp|location=Sequence derived from alignment at L-elsbetiae_contig987:18137..22623- (Laminarionema elsbetiae ELsaHSoW15)back to top |