prot_L-elsbetiae_contig9786.18742.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig9786.18742.1 vs. uniprot
Match: D7FJ03_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FJ03_ECTSI) HSP 1 Score: 70.5 bits (171), Expect = 9.520e-15 Identity = 37/46 (80.43%), Postives = 39/46 (84.78%), Query Frame = 0 Query: 1 FRSDVEVAFSSASLATIACNTLAVDAELQPDKIIRTLRVEGSSLRA 46 + D EV F SASLATIAC TLAVDAELQP+KIIRTLRVEGSSL A Sbjct: 5 YHCDAEVTFPSASLATIACRTLAVDAELQPNKIIRTLRVEGSSLLA 50
BLAST of mRNA_L-elsbetiae_contig9786.18742.1 vs. uniprot
Match: K3WQ75_GLOUD (Uncharacterized protein n=1 Tax=Globisporangium ultimum (strain ATCC 200006 / CBS 805.95 / DAOM BR144) TaxID=431595 RepID=K3WQ75_GLOUD) HSP 1 Score: 48.1 bits (113), Expect = 5.320e-6 Identity = 25/44 (56.82%), Postives = 30/44 (68.18%), Query Frame = 0 Query: 1 FRSDVEVAFSSASLATIACNTLAVDAELQPDKIIRTLRVEGSSL 44 + D+ +AF A A A TL VDAELQPDKI RTL VEG++L Sbjct: 7 YECDISLAFPEAVDAAYALETLRVDAELQPDKITRTLAVEGTNL 50 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig9786.18742.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig9786.18742.1 ID=prot_L-elsbetiae_contig9786.18742.1|Name=mRNA_L-elsbetiae_contig9786.18742.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=47bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|