prot_L-elsbetiae_contig968.18654.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig968.18654.1 vs. uniprot
Match: D8LR20_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LR20_ECTSI) HSP 1 Score: 111 bits (278), Expect = 3.360e-27 Identity = 57/66 (86.36%), Postives = 62/66 (93.94%), Query Frame = 0 Query: 1 MALRRAPTRPLGKMPILGADISVIVSEEPLEPVTATPPDEEAISKIWAAAAERQPMSMRGRRSRWG 66 +ALRRAPTRPLGKMP+LG DIS+IVSEEPLEPVTATP D+EAIS+IWAAAAERQPM RGRRSRWG Sbjct: 168 LALRRAPTRPLGKMPVLGGDISIIVSEEPLEPVTATPADQEAISRIWAAAAERQPM--RGRRSRWG 231
BLAST of mRNA_L-elsbetiae_contig968.18654.1 vs. uniprot
Match: A0A6H5KUY1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KUY1_9PHAE) HSP 1 Score: 80.5 bits (197), Expect = 1.660e-16 Identity = 38/46 (82.61%), Postives = 44/46 (95.65%), Query Frame = 0 Query: 1 MALRRAPTRPLGKMPILGADISVIVSEEPLEPVTATPPDEEAISKI 46 +ALRRAPTRPLGKMP+LG DIS+IVSEEPLEPVTATP D+EAIS++ Sbjct: 207 LALRRAPTRPLGKMPVLGGDISIIVSEEPLEPVTATPADQEAISRV 252 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig968.18654.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig968.18654.1 ID=prot_L-elsbetiae_contig968.18654.1|Name=mRNA_L-elsbetiae_contig968.18654.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=83bpback to top |