prot_L-elsbetiae_contig9657.18635.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig9657.18635.1 vs. uniprot
Match: A0A6H5L5H1_9PHAE (Protein kinase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L5H1_9PHAE) HSP 1 Score: 79.7 bits (195), Expect = 2.290e-14 Identity = 44/58 (75.86%), Postives = 50/58 (86.21%), Query Frame = 0 Query: 91 FDAPTAPYRGEDGLHSKAKXXXXXXXXXPVRKWKNALSFAGRAFKDVVGGDLHPGFTN 148 + APTAPYRGEDG+ SKAKXXXXXXXXX R+WKNALSFAG+ K +VG DLHPG+TN Sbjct: 1053 YHAPTAPYRGEDGILSKAKXXXXXXXXXXARRWKNALSFAGKHLKGIVGADLHPGYTN 1110
BLAST of mRNA_L-elsbetiae_contig9657.18635.1 vs. uniprot
Match: D7FM46_ECTSI (Putative Leucine Rich Repeat Protein Kinase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FM46_ECTSI) HSP 1 Score: 75.5 bits (184), Expect = 6.620e-13 Identity = 49/105 (46.67%), Postives = 62/105 (59.05%), Query Frame = 0 Query: 46 AFFGGDSQWGDXXXXXXSRVPSHAGFSRADSESFSNYSGSRSQLVFDAPTAPYRGEDGLHSKAKXXXXXXXXXPVRKWKNALSFAGRAFKDVVGGDLHPGFTNDA 150 A +GG +W R P ++G + + + + PTAPYRGEDG+ SKA XXXXXXXXX RKWKNA SFAG+ KD+V DLHPGFT+ + Sbjct: 752 AAYGGGEEW---VGGGDGRAPGNSGDGGGQWMNAHQHQYPGAAAPYHTPTAPYRGEDGIQSKAXXXXXXXXXXXXRKWKNAFSFAGKHLKDIVAVDLHPGFTDSS 853 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig9657.18635.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig9657.18635.1 ID=prot_L-elsbetiae_contig9657.18635.1|Name=mRNA_L-elsbetiae_contig9657.18635.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=159bpback to top |