prot_L-elsbetiae_contig9136.18166.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig9136.18166.1 vs. uniprot
Match: D7FX81_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FX81_ECTSI) HSP 1 Score: 58.5 bits (140), Expect = 3.460e-6 Identity = 27/39 (69.23%), Postives = 34/39 (87.18%), Query Frame = 0 Query: 1 MGNMCTNAQGADDRRRKPDSRRKSSGSTTGFSPTEEIAY 39 MGN+CT+ + A+D RR+PDSRRK SGSTTGFSPTE++ Y Sbjct: 1 MGNLCTSTKSANDGRRQPDSRRKGSGSTTGFSPTEDLGY 39
BLAST of mRNA_L-elsbetiae_contig9136.18166.1 vs. uniprot
Match: A0A6H5JVK9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JVK9_9PHAE) HSP 1 Score: 56.6 bits (135), Expect = 4.470e-5 Identity = 26/39 (66.67%), Postives = 34/39 (87.18%), Query Frame = 0 Query: 1 MGNMCTNAQGADDRRRKPDSRRKSSGSTTGFSPTEEIAY 39 MGN+CT+ + A+D RR+PDSRRK SGSTTGFSPTE++ + Sbjct: 1 MGNLCTSTKSANDGRRQPDSRRKGSGSTTGFSPTEDLGH 39 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig9136.18166.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig9136.18166.1 ID=prot_L-elsbetiae_contig9136.18166.1|Name=mRNA_L-elsbetiae_contig9136.18166.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=388bpback to top |