prot_L-elsbetiae_contig9131.18162.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig9131.18162.1 vs. uniprot
Match: D7G8X0_ECTSI (Mitochondrial carrier protein-like n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G8X0_ECTSI) HSP 1 Score: 57.0 bits (136), Expect = 1.840e-7 Identity = 26/31 (83.87%), Postives = 28/31 (90.32%), Query Frame = 0 Query: 26 LAYIVADDGWKGLDAGSQPRVVMSGLFTAIG 56 +A IVADDGWKGL AG QPRVVMSGLFTA+G Sbjct: 279 MATIVADDGWKGLYAGFQPRVVMSGLFTAVG 309
BLAST of mRNA_L-elsbetiae_contig9131.18162.1 vs. uniprot
Match: A0A6H5JI22_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JI22_9PHAE) HSP 1 Score: 57.0 bits (136), Expect = 1.950e-7 Identity = 26/31 (83.87%), Postives = 28/31 (90.32%), Query Frame = 0 Query: 26 LAYIVADDGWKGLDAGSQPRVVMSGLFTAIG 56 +A IVADDGWKGL AG QPRVVMSGLFTA+G Sbjct: 407 MATIVADDGWKGLYAGFQPRVVMSGLFTAVG 437 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig9131.18162.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig9131.18162.1 ID=prot_L-elsbetiae_contig9131.18162.1|Name=mRNA_L-elsbetiae_contig9131.18162.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=92bpback to top |