mRNA_L-elsbetiae_contig9131.18162.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig9131.18162.1 vs. uniprot
Match: D7G8X0_ECTSI (Mitochondrial carrier protein-like n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G8X0_ECTSI) HSP 1 Score: 57.0 bits (136), Expect = 1.840e-7 Identity = 26/31 (83.87%), Postives = 28/31 (90.32%), Query Frame = 1 Query: 76 LAYIVADDGWKGLDAGSQPRVVMSGLFTAIG 168 +A IVADDGWKGL AG QPRVVMSGLFTA+G Sbjct: 279 MATIVADDGWKGLYAGFQPRVVMSGLFTAVG 309
BLAST of mRNA_L-elsbetiae_contig9131.18162.1 vs. uniprot
Match: A0A6H5JI22_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JI22_9PHAE) HSP 1 Score: 57.0 bits (136), Expect = 1.950e-7 Identity = 26/31 (83.87%), Postives = 28/31 (90.32%), Query Frame = 1 Query: 76 LAYIVADDGWKGLDAGSQPRVVMSGLFTAIG 168 +A IVADDGWKGL AG QPRVVMSGLFTA+G Sbjct: 407 MATIVADDGWKGLYAGFQPRVVMSGLFTAVG 437 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig9131.18162.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig9131.18162.1 >prot_L-elsbetiae_contig9131.18162.1 ID=prot_L-elsbetiae_contig9131.18162.1|Name=mRNA_L-elsbetiae_contig9131.18162.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=92bp MSVFCWLERSDQVPGRRSGLREEHRLAYIVADDGWKGLDAGSQPRVVMSGback to top mRNA from alignment at L-elsbetiae_contig9131:2377..3791+ Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig9131.18162.1 ID=mRNA_L-elsbetiae_contig9131.18162.1|Name=mRNA_L-elsbetiae_contig9131.18162.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=1415bp|location=Sequence derived from alignment at L-elsbetiae_contig9131:2377..3791+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig9131:2377..3791+ >mRNA_L-elsbetiae_contig9131.18162.1 ID=mRNA_L-elsbetiae_contig9131.18162.1|Name=mRNA_L-elsbetiae_contig9131.18162.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=552bp|location=Sequence derived from alignment at L-elsbetiae_contig9131:2377..3791+ (Laminarionema elsbetiae ELsaHSoW15)back to top |