prot_L-elsbetiae_contig9121.18153.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig9121.18153.1 vs. uniprot
Match: D7FT95_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FT95_ECTSI) HSP 1 Score: 75.9 bits (185), Expect = 8.690e-12 Identity = 44/85 (51.76%), Postives = 55/85 (64.71%), Query Frame = 0 Query: 4 LHVILREGMPTRLWMG-APARETRSAKILNATRVPVVRAREVTWNLRASALRNM-GNSFSKAKRFTFGDEFNGSV-RGVAWPRGL 85 L + ++ G PTRLW G A RETRS K N TRVPVVRAR VTW L ALRNM G+++S+ F+ G F+ + RG+ WP L Sbjct: 52 LKLNVQHGTPTRLWRGTATTRETRSVKRRNVTRVPVVRARTVTWKLPGLALRNMTGDAWSEVTTFSLGPGFDDDLPRGIQWPEKL 136
BLAST of mRNA_L-elsbetiae_contig9121.18153.1 vs. uniprot
Match: A0A6H5JA08_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JA08_9PHAE) HSP 1 Score: 73.6 bits (179), Expect = 1.580e-10 Identity = 43/85 (50.59%), Postives = 54/85 (63.53%), Query Frame = 0 Query: 4 LHVILREGMPTRLWMG-APARETRSAKILNATRVPVVRAREVTWNLRASALRNM-GNSFSKAKRFTFGDEFNGSV-RGVAWPRGL 85 L + ++ G P RLW G A RETRS K N TRVPVVRAR VTW L ALRNM G+++S+ F+ G F+ + RG+ WP L Sbjct: 83 LKLNVQHGTPPRLWRGTATTRETRSVKRRNVTRVPVVRARTVTWKLPGVALRNMTGDAWSEVTTFSLGPGFDDDLPRGIQWPEKL 167 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig9121.18153.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig9121.18153.1 ID=prot_L-elsbetiae_contig9121.18153.1|Name=mRNA_L-elsbetiae_contig9121.18153.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=411bpback to top |