mRNA_L-elsbetiae_contig8814.17846.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig8814.17846.1 vs. uniprot
Match: D7FLJ6_ECTSI (Asn/thr-rich large protein family protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FLJ6_ECTSI) HSP 1 Score: 68.2 bits (165), Expect = 2.010e-11 Identity = 36/69 (52.17%), Postives = 48/69 (69.57%), Query Frame = 2 Query: 2 LTGSTTFINNSAFWGGAIYNNIPDD----PETMTTFPGGTIFDGNEAENCPDVNNANVFDGNNENCPVV 196 L GSTTF N+AF GGAIY + D+ P ++TTFP T+F+ N AE+CPDV+N G+++NCPVV Sbjct: 318 LMGSTTFRENAAFMGGAIYTSDGDEENGEPASVTTFPDDTVFEDNSAEHCPDVHN-----GDSDNCPVV 381
BLAST of mRNA_L-elsbetiae_contig8814.17846.1 vs. uniprot
Match: D8LJ44_ECTSI (Asn/thr-rich large protein family protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LJ44_ECTSI) HSP 1 Score: 63.2 bits (152), Expect = 1.210e-9 Identity = 34/69 (49.28%), Postives = 45/69 (65.22%), Query Frame = 2 Query: 2 LTGSTTFINNSAFWGGAIYNN----IPDDPETMTTFPGGTIFDGNEAENCPDVNNANVFDGNNENCPVV 196 L GSTTF N+A+ GGAIY + + ++TTFP T+F+ N A+ CPDV FDG+N+NCPVV Sbjct: 318 LMGSTTFRENAAYEGGAIYTDDGSVANGEAASVTTFPDDTVFEDNRADFCPDV-----FDGDNDNCPVV 381
BLAST of mRNA_L-elsbetiae_contig8814.17846.1 vs. uniprot
Match: D7FQG1_ECTSI (Polymorphic outer membrane protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FQG1_ECTSI) HSP 1 Score: 59.3 bits (142), Expect = 7.100e-9 Identity = 35/68 (51.47%), Postives = 44/68 (64.71%), Query Frame = 2 Query: 2 LTGSTTFINNSAFWGGAIYNNIPDD--PETMTTFPGGTIFDGNEAEN-CPDVNNANVFDGNNENCPVV 196 L G TTF N A+WGGAIY DD P ++TTFP T+F+ N A+ CPDV+N G++ NCPVV Sbjct: 113 LMGPTTFRENGAWWGGAIYT---DDGYPASVTTFPDDTVFEDNSADAYCPDVHN-----GDDNNCPVV 172 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig8814.17846.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig8814.17846.1 >prot_L-elsbetiae_contig8814.17846.1 ID=prot_L-elsbetiae_contig8814.17846.1|Name=mRNA_L-elsbetiae_contig8814.17846.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=38bp MTTFPGGTIFDGNEAENCPDVNNANVFDGNNENCPVV*back to top mRNA from alignment at L-elsbetiae_contig8814:4899..6012+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig8814.17846.1 ID=mRNA_L-elsbetiae_contig8814.17846.1|Name=mRNA_L-elsbetiae_contig8814.17846.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=1114bp|location=Sequence derived from alignment at L-elsbetiae_contig8814:4899..6012+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig8814:4899..6012+ >mRNA_L-elsbetiae_contig8814.17846.1 ID=mRNA_L-elsbetiae_contig8814.17846.1|Name=mRNA_L-elsbetiae_contig8814.17846.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=228bp|location=Sequence derived from alignment at L-elsbetiae_contig8814:4899..6012+ (Laminarionema elsbetiae ELsaHSoW15)back to top |