prot_L-elsbetiae_contig7893.16842.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig7893.16842.1 vs. uniprot
Match: A0A482UL51_9ARCH (Vacuolar protein 8 n=1 Tax=archaeon TaxID=1906665 RepID=A0A482UL51_9ARCH) HSP 1 Score: 54.7 bits (130), Expect = 5.410e-6 Identity = 25/45 (55.56%), Postives = 38/45 (84.44%), Query Frame = 0 Query: 1 MAQEGGIDMLVAMLESTHPNLQRQASKALANLGVNSNNKERICKA 45 MA+EG ++ L+A+L+S+H +QRQA+KALANLGV+ +NK++I A Sbjct: 143 MAEEGAVESLIAILDSSHDLVQRQAAKALANLGVHHDNKQKIADA 187
BLAST of mRNA_L-elsbetiae_contig7893.16842.1 vs. uniprot
Match: A0A397ACU4_9STRA (Vacuolar protein 8 n=1 Tax=Aphanomyces astaci TaxID=112090 RepID=A0A397ACU4_9STRA) HSP 1 Score: 53.5 bits (127), Expect = 1.270e-5 Identity = 25/36 (69.44%), Postives = 33/36 (91.67%), Query Frame = 0 Query: 1 MAQEGGIDMLVAMLESTHPNLQRQASKALANLGVNS 36 MA EGGIDML+ +L+ST+ ++QRQA+KALANLGVN+ Sbjct: 128 MANEGGIDMLIHLLQSTNEHVQRQAAKALANLGVNA 163
BLAST of mRNA_L-elsbetiae_contig7893.16842.1 vs. uniprot
Match: A0A418DV07_9STRA (Vacuolar protein 8 n=1 Tax=Aphanomyces astaci TaxID=112090 RepID=A0A418DV07_9STRA) HSP 1 Score: 53.1 bits (126), Expect = 1.900e-5 Identity = 25/35 (71.43%), Postives = 32/35 (91.43%), Query Frame = 0 Query: 1 MAQEGGIDMLVAMLESTHPNLQRQASKALANLGVN 35 MA EGGIDML+ +L+ST+ ++QRQA+KALANLGVN Sbjct: 128 MANEGGIDMLIHLLQSTNEHVQRQAAKALANLGVN 162
BLAST of mRNA_L-elsbetiae_contig7893.16842.1 vs. uniprot
Match: A0A6A5AFC1_9STRA (Vacuolar protein 8 n=1 Tax=Aphanomyces astaci TaxID=112090 RepID=A0A6A5AFC1_9STRA) HSP 1 Score: 53.1 bits (126), Expect = 2.740e-5 Identity = 25/35 (71.43%), Postives = 32/35 (91.43%), Query Frame = 0 Query: 1 MAQEGGIDMLVAMLESTHPNLQRQASKALANLGVN 35 MA EGGIDML+ +L+ST+ ++QRQA+KALANLGVN Sbjct: 109 MANEGGIDMLIHLLQSTNEHVQRQAAKALANLGVN 143 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig7893.16842.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 4
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig7893.16842.1 ID=prot_L-elsbetiae_contig7893.16842.1|Name=mRNA_L-elsbetiae_contig7893.16842.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=164bpback to top |