mRNA_L-elsbetiae_contig7768.16711.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig7768.16711.1 vs. uniprot
Match: A0A6H5KCM2_9PHAE (Zn(2)-C6 fungal-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KCM2_9PHAE) HSP 1 Score: 68.2 bits (165), Expect = 3.380e-12 Identity = 28/46 (60.87%), Postives = 33/46 (71.74%), Query Frame = 2 Query: 194 LRASCDFCTRRKRKCDGDGVSRCSFCIAKKQPECHYGVRLLTGPRA 331 +R SCDFC RK++CDGDGV+RCS+CI KK P C Y R PRA Sbjct: 45 IRKSCDFCNGRKKRCDGDGVNRCSYCIIKKNPHCIYSPRRPQKPRA 90
BLAST of mRNA_L-elsbetiae_contig7768.16711.1 vs. uniprot
Match: A0A6H5K678_9PHAE (Zn(2)-C6 fungal-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K678_9PHAE) HSP 1 Score: 62.8 bits (151), Expect = 4.400e-9 Identity = 24/41 (58.54%), Postives = 31/41 (75.61%), Query Frame = 2 Query: 194 LRASCDFCTRRKRKCDGDGVSRCSFCIAKKQPECHYGVRLL 316 L+ SCDFC +R+++CDG RCSFCI K +PECHY +R L Sbjct: 100 LKKSCDFCFKRRKRCDGRAQRRCSFCIEKGRPECHYSMRSL 140
BLAST of mRNA_L-elsbetiae_contig7768.16711.1 vs. uniprot
Match: D7FTE0_ECTSI (Zn(2)-C6 fungal-type domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FTE0_ECTSI) HSP 1 Score: 55.8 bits (133), Expect = 1.190e-6 Identity = 31/83 (37.35%), Postives = 40/83 (48.19%), Query Frame = 2 Query: 71 MANIKKDPSFGASSRADKGAGSLPVTTMTP-RLAPTAVPSGRLRASCDFCTRRKRKCDGDGVSRCSFCIAKKQPECHYGVRLL 316 M ++P+ + + P T TP A A P + SC FC +RKR CD RCS CI KKQP CHY ++ L Sbjct: 12 MVATTQEPTVMEGMQRQPQSAGQPAYTATPAEAAVEAAPPRQTYKSCTFCAKRKRACDSQRP-RCSLCIEKKQPYCHYPLKPL 93 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig7768.16711.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig7768.16711.1 >prot_L-elsbetiae_contig7768.16711.1 ID=prot_L-elsbetiae_contig7768.16711.1|Name=mRNA_L-elsbetiae_contig7768.16711.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=117bp YNLWFLADSQKAGDDTLAFPGTIDGQYKEGPELWSQQPGGQRGWESTGNHback to top mRNA from alignment at L-elsbetiae_contig7768:7016..9057+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig7768.16711.1 ID=mRNA_L-elsbetiae_contig7768.16711.1|Name=mRNA_L-elsbetiae_contig7768.16711.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=2042bp|location=Sequence derived from alignment at L-elsbetiae_contig7768:7016..9057+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig7768:7016..9057+ >mRNA_L-elsbetiae_contig7768.16711.1 ID=mRNA_L-elsbetiae_contig7768.16711.1|Name=mRNA_L-elsbetiae_contig7768.16711.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=702bp|location=Sequence derived from alignment at L-elsbetiae_contig7768:7016..9057+ (Laminarionema elsbetiae ELsaHSoW15)back to top |