prot_L-elsbetiae_contig7528.16423.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig7528.16423.1 vs. uniprot
Match: A0A6H5KT07_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KT07_9PHAE) HSP 1 Score: 66.2 bits (160), Expect = 7.770e-10 Identity = 33/48 (68.75%), Postives = 37/48 (77.08%), Query Frame = 0 Query: 73 EDEPMRKGEVGTEPAEYLASSQTGHIKLQAGGTVFADSVGQTAGEDGP 120 E RKGE+GTEPAEYLASSQ GHI+LQAGGTV++DSV DGP Sbjct: 5957 ESSAARKGEIGTEPAEYLASSQAGHIRLQAGGTVYSDSVVAEIEVDGP 6004
BLAST of mRNA_L-elsbetiae_contig7528.16423.1 vs. uniprot
Match: D8LCZ5_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LCZ5_ECTSI) HSP 1 Score: 65.5 bits (158), Expect = 1.440e-9 Identity = 33/48 (68.75%), Postives = 37/48 (77.08%), Query Frame = 0 Query: 73 EDEPMRKGEVGTEPAEYLASSQTGHIKLQAGGTVFADSVGQTAGEDGP 120 E RKGE+GTEPAEYLASSQ GHI+LQAGGTV++DSV DGP Sbjct: 5421 ESAAARKGEIGTEPAEYLASSQAGHIRLQAGGTVYSDSVVGEIKMDGP 5468 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig7528.16423.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig7528.16423.1 ID=prot_L-elsbetiae_contig7528.16423.1|Name=mRNA_L-elsbetiae_contig7528.16423.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=145bpback to top |