prot_L-elsbetiae_contig7450.16338.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig7450.16338.1 vs. uniprot
Match: A0A6H5KNK6_9PHAE (Palmitoyltransferase n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KNK6_9PHAE) HSP 1 Score: 82.8 bits (203), Expect = 1.350e-15 Identity = 61/111 (54.95%), Postives = 70/111 (63.06%), Query Frame = 0 Query: 30 GSSSKGKMGKLRKSLSRRLSLSRRSSSGSTPQHDGYSAGFTSVAGTDEARNGRDATGDQEQPXXXXXXXXXXXPSPGVAVVYSPMAAPAPRRAP-----VSPALPGAPVSS 135 G++SKGKMGK+RKSLSRRLSLSRRSSS STP H+ YS GFTSVAG++E R RD + EQ GV VV+ M P R AP +SP PGAPVSS Sbjct: 44 GTNSKGKMGKIRKSLSRRLSLSRRSSSSSTPNHERYS-GFTSVAGSEEGRYDRDGVPENEQALASPA---------GVPVVFPGMGPPVARGAPQGRNLLSPVPPGAPVSS 144 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig7450.16338.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig7450.16338.1 ID=prot_L-elsbetiae_contig7450.16338.1|Name=mRNA_L-elsbetiae_contig7450.16338.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=149bpback to top |