mRNA_L-elsbetiae_contig7365.16237.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig7365.16237.1 vs. uniprot
Match: A0A6H5K0S2_9PHAE (Uncharacterized protein n=6 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K0S2_9PHAE) HSP 1 Score: 59.7 bits (143), Expect = 1.830e-9 Identity = 30/60 (50.00%), Postives = 37/60 (61.67%), Query Frame = 1 Query: 61 CTMVFEDYMAALYLAKNPATTPNSK----QHRHVRERVANAEIKIVHVPSSYHHADFLTK 228 C VFED A+ LA+NP + NSK +H +RE V EI ++HVPS Y HA FLTK Sbjct: 9 CIPVFEDNQGAIQLAQNPISNSNSKHIDVRHHFLRELVERKEISVIHVPSPYQHAYFLTK 68
BLAST of mRNA_L-elsbetiae_contig7365.16237.1 vs. uniprot
Match: A0A6H5LE52_9PHAE (Integrase catalytic domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LE52_9PHAE) HSP 1 Score: 63.5 bits (153), Expect = 2.160e-9 Identity = 33/67 (49.25%), Postives = 41/67 (61.19%), Query Frame = 1 Query: 61 CTMVFEDYMAALYLAKNPATTPNSKQ----HRHVRERVANAEIKIVHVPSSYHHADFLTK--PQGSF 243 C VFED A+ LA+NP + NSK H +RE V EI ++HVPS Y HADFLTK P+ +F Sbjct: 1514 CIPVFEDNQGAIQLAQNPISNSNSKHIDVTHHFLRELVERKEISVIHVPSPYQHADFLTKSLPKDAF 1580
BLAST of mRNA_L-elsbetiae_contig7365.16237.1 vs. uniprot
Match: A0A6H5K039_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K039_9PHAE) HSP 1 Score: 58.9 bits (141), Expect = 3.390e-9 Identity = 30/60 (50.00%), Postives = 37/60 (61.67%), Query Frame = 1 Query: 61 CTMVFEDYMAALYLAKNPATTPNSK----QHRHVRERVANAEIKIVHVPSSYHHADFLTK 228 C VFED A+ LA+NP + NSK +H +RE V EI ++HVPS Y ADFLTK Sbjct: 9 CIPVFEDIQEAIQLAQNPISNSNSKHIVVRHHCLRELVERNEISVIHVPSPYQRADFLTK 68
BLAST of mRNA_L-elsbetiae_contig7365.16237.1 vs. uniprot
Match: A0A6H5JHP4_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JHP4_9PHAE) HSP 1 Score: 62.4 bits (150), Expect = 5.120e-9 Identity = 30/60 (50.00%), Postives = 38/60 (63.33%), Query Frame = 1 Query: 61 CTMVFEDYMAALYLAKNPATTPNSK----QHRHVRERVANAEIKIVHVPSSYHHADFLTK 228 C +FED A+ LA+NP + NSK +H +RE V EI ++HVPS YH ADFLTK Sbjct: 483 CIPIFEDNQRAIQLAQNPISNSNSKHIDVRHHFLRELVERKEISVIHVPSPYHRADFLTK 542
BLAST of mRNA_L-elsbetiae_contig7365.16237.1 vs. uniprot
Match: A0A6H5JUW6_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JUW6_9PHAE) HSP 1 Score: 60.8 bits (146), Expect = 6.570e-9 Identity = 32/67 (47.76%), Postives = 41/67 (61.19%), Query Frame = 1 Query: 61 CTMVFEDYMAALYLAKNPATTPNSK----QHRHVRERVANAEIKIVHVPSSYHHADFLTK--PQGSF 243 C VFED A+ LA+NP + NSK +H +RE V EI ++HVPS Y ADFLTK P+ +F Sbjct: 134 CIPVFEDNQGAIQLAQNPISNSNSKHIDVRHHFLRELVERKEISVIHVPSPYQRADFLTKSLPKDAF 200
BLAST of mRNA_L-elsbetiae_contig7365.16237.1 vs. uniprot
Match: A0A6H5KEZ8_9PHAE (Uncharacterized protein n=4 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KEZ8_9PHAE) HSP 1 Score: 60.1 bits (144), Expect = 1.360e-8 Identity = 30/60 (50.00%), Postives = 37/60 (61.67%), Query Frame = 1 Query: 61 CTMVFEDYMAALYLAKNPATTPNSK----QHRHVRERVANAEIKIVHVPSSYHHADFLTK 228 C VFED A+ LA+NP + NSK +H +RE V EI ++HVPS Y ADFLTK Sbjct: 139 CIPVFEDNQGAIQLAQNPISNSNSKHIDVRHHFLRELVERKEISVIHVPSPYQRADFLTK 198
BLAST of mRNA_L-elsbetiae_contig7365.16237.1 vs. uniprot
Match: A0A6H5KPF9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KPF9_9PHAE) HSP 1 Score: 60.8 bits (146), Expect = 1.580e-8 Identity = 32/67 (47.76%), Postives = 41/67 (61.19%), Query Frame = 1 Query: 61 CTMVFEDYMAALYLAKNPATTPNSK----QHRHVRERVANAEIKIVHVPSSYHHADFLTK--PQGSF 243 C VFED A+ LA+NP + NSK +H +RE V EI ++HVPS Y ADFLTK P+ +F Sbjct: 274 CIPVFEDNQGAIQLAQNPISNSNSKHIDVRHHFLRELVERKEISVIHVPSPYQRADFLTKRLPKDAF 340
BLAST of mRNA_L-elsbetiae_contig7365.16237.1 vs. uniprot
Match: A0A6H5JFG2_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JFG2_9PHAE) HSP 1 Score: 60.8 bits (146), Expect = 1.730e-8 Identity = 32/67 (47.76%), Postives = 41/67 (61.19%), Query Frame = 1 Query: 61 CTMVFEDYMAALYLAKNPATTPNSK----QHRHVRERVANAEIKIVHVPSSYHHADFLTK--PQGSF 243 C VFED A+ LA+NP + NSK +H +RE V EI ++HVPS Y ADFLTK P+ +F Sbjct: 385 CIPVFEDNQGAIQLAQNPISNSNSKHIDVRHHFLRELVERKEISVIHVPSPYQRADFLTKSLPKDAF 451
BLAST of mRNA_L-elsbetiae_contig7365.16237.1 vs. uniprot
Match: A0A6H5K2E9_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K2E9_9PHAE) HSP 1 Score: 60.8 bits (146), Expect = 1.840e-8 Identity = 32/67 (47.76%), Postives = 41/67 (61.19%), Query Frame = 1 Query: 61 CTMVFEDYMAALYLAKNPATTPNSK----QHRHVRERVANAEIKIVHVPSSYHHADFLTK--PQGSF 243 C VFED A+ LA+NP + NSK +H +RE V EI ++HVPS Y ADFLTK P+ +F Sbjct: 779 CIPVFEDNQGAIQLAQNPISNSNSKHIDVRHHFLRELVERKEISVIHVPSPYQRADFLTKSFPKDAF 845
BLAST of mRNA_L-elsbetiae_contig7365.16237.1 vs. uniprot
Match: A0A6H5J4N2_9PHAE (Integrase catalytic domain-containing protein n=18 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J4N2_9PHAE) HSP 1 Score: 60.8 bits (146), Expect = 1.910e-8 Identity = 32/67 (47.76%), Postives = 41/67 (61.19%), Query Frame = 1 Query: 61 CTMVFEDYMAALYLAKNPATTPNSK----QHRHVRERVANAEIKIVHVPSSYHHADFLTK--PQGSF 243 C VFED A+ LA+NP + NSK +H +RE V EI ++HVPS Y ADFLTK P+ +F Sbjct: 1721 CIPVFEDNQGAIQLAQNPISNSNSKHIDVRHHFLRELVERKEISVIHVPSPYQRADFLTKSLPKDAF 1787 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig7365.16237.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig7365.16237.1 >prot_L-elsbetiae_contig7365.16237.1 ID=prot_L-elsbetiae_contig7365.16237.1|Name=mRNA_L-elsbetiae_contig7365.16237.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=112bp GVEGGDLSEFFVEFSDRDEGCTMVFEDYMAALYLAKNPATTPNSKQHRHVback to top mRNA from alignment at L-elsbetiae_contig7365:6745..7081+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig7365.16237.1 ID=mRNA_L-elsbetiae_contig7365.16237.1|Name=mRNA_L-elsbetiae_contig7365.16237.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=337bp|location=Sequence derived from alignment at L-elsbetiae_contig7365:6745..7081+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig7365:6745..7081+ >mRNA_L-elsbetiae_contig7365.16237.1 ID=mRNA_L-elsbetiae_contig7365.16237.1|Name=mRNA_L-elsbetiae_contig7365.16237.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=672bp|location=Sequence derived from alignment at L-elsbetiae_contig7365:6745..7081+ (Laminarionema elsbetiae ELsaHSoW15)back to top |