prot_L-elsbetiae_contig7262.16132.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig7262.16132.1 vs. uniprot
Match: A0A4R0RUG8_9APHY (Uncharacterized protein n=1 Tax=Steccherinum ochraceum TaxID=92696 RepID=A0A4R0RUG8_9APHY) HSP 1 Score: 60.1 bits (144), Expect = 1.260e-8 Identity = 37/88 (42.05%), Postives = 44/88 (50.00%), Query Frame = 0 Query: 1 GNSQSYA--DATGTTCEGDRTNFDGNLPGDDELNIMTGWHCASQDQCGFFRGVGMRGWMGGEDGTKVMIFEVDMPHCETCERNRPAVW 86 GNSQSY+ D T + + NLPG E+NI+TG CA GF RG GW G+K IFE DMP N PA+W Sbjct: 145 GNSQSYSNGDFTDAAASPNADTYSANLPGTQEVNIVTGTSCADVPCDGFARGTASHGW----SGSKAFIFEFDMP--SDGSSNPPAIW 226
BLAST of mRNA_L-elsbetiae_contig7262.16132.1 vs. uniprot
Match: A0A4S4LVY0_9APHY (Uncharacterized protein n=1 Tax=Antrodiella citrinella TaxID=2447956 RepID=A0A4S4LVY0_9APHY) HSP 1 Score: 56.2 bits (134), Expect = 2.910e-7 Identity = 34/88 (38.64%), Postives = 45/88 (51.14%), Query Frame = 0 Query: 1 GNSQSYADA--TGTTCEGDRTNFDGNLPGDDELNIMTGWHCASQDQCGFFRGVGMRGWMGGEDGTKVMIFEVDMPHCETCERNRPAVW 86 G SQ+Y+D TG + + NLPG +E+NI+T CA GF RG GW G+K +FE +MP T N PA+W Sbjct: 146 GASQAYSDGAFTGAAASANADIYGANLPGTNEVNIVTSQTCADSPCDGFARGTASHGWA----GSKAFVFEFEMPQDGTS--NPPAIW 227 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig7262.16132.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig7262.16132.1 ID=prot_L-elsbetiae_contig7262.16132.1|Name=mRNA_L-elsbetiae_contig7262.16132.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=87bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|