prot_L-elsbetiae_contig7202.16049.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig7202.16049.1 vs. uniprot
Match: A0A6H5J9J6_9PHAE (S4 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J9J6_9PHAE) HSP 1 Score: 54.7 bits (130), Expect = 1.760e-7 Identity = 30/41 (73.17%), Postives = 33/41 (80.49%), Query Frame = 0 Query: 2 KDVFMMRLSRRIARSGMASLREAEYLVEAGVVTVNETPVQT 42 KD +MRLSRRIARSG+AS REAE +VEAGVV VN VQT Sbjct: 108 KDPSVMRLSRRIARSGIASRREAERMVEAGVVMVNGATVQT 148
BLAST of mRNA_L-elsbetiae_contig7202.16049.1 vs. uniprot
Match: D8LDE8_ECTSI (RNA pseudouridylate synthase domain-containing protein (C-terminal) RNA pseudouridylate synthase dom n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LDE8_ECTSI) HSP 1 Score: 54.7 bits (130), Expect = 1.910e-7 Identity = 30/41 (73.17%), Postives = 33/41 (80.49%), Query Frame = 0 Query: 2 KDVFMMRLSRRIARSGMASLREAEYLVEAGVVTVNETPVQT 42 KD +MRLSRRIARSG+AS REAE +VEAGVV VN VQT Sbjct: 108 KDPSVMRLSRRIARSGIASRREAERMVEAGVVMVNGATVQT 148 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig7202.16049.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig7202.16049.1 ID=prot_L-elsbetiae_contig7202.16049.1|Name=mRNA_L-elsbetiae_contig7202.16049.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=45bpback to top |