prot_L-elsbetiae_contig720.16047.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig720.16047.1 vs. uniprot
Match: A0A8K0TT44_9PEZI (WSC domain-containing protein n=1 Tax=Plectosphaerella cucumerina TaxID=40658 RepID=A0A8K0TT44_9PEZI) HSP 1 Score: 51.2 bits (121), Expect = 8.470e-6 Identity = 28/66 (42.42%), Postives = 34/66 (51.52%), Query Frame = 0 Query: 5 LKTCIADAAFKTYYFA-LAEGSACYCGNP-----QPVDEERGICEEPCAGDVSSVCGGVNSYDLYE 64 ++TCIA + Y +A L CYCGN PV G+CE PC GD S +CGG LYE Sbjct: 386 VETCIAFCNDRGYKYAGLEYQRECYCGNDVAADRAPVKGILGVCEMPCKGDNSQICGGYGGLSLYE 451
BLAST of mRNA_L-elsbetiae_contig720.16047.1 vs. uniprot
Match: A0A086TF94_ACRC1 (Galactose oxidase-like protein n=1 Tax=Acremonium chrysogenum (strain ATCC 11550 / CBS 779.69 / DSM 880 / IAM 14645 / JCM 23072 / IMI 49137) TaxID=857340 RepID=A0A086TF94_ACRC1) HSP 1 Score: 50.8 bits (120), Expect = 1.170e-5 Identity = 24/69 (34.78%), Postives = 36/69 (52.17%), Query Frame = 0 Query: 1 PQACLKTCIADAAFKTYYFALAEGSACYCGNPQPVDE------ERGICEEPCAGDVSSVCGGVNSYDLY 63 P C C A F A+ G+ CYCG+P +D + G+C+ PCAG+ +++CGG +S Y Sbjct: 52 PMVCTNAC---AEFGYMAAAMGHGNICYCGDPANIDTAGAKFVDEGLCDIPCAGNGTAMCGGGSSLSTY 117
BLAST of mRNA_L-elsbetiae_contig720.16047.1 vs. uniprot
Match: W6Q5D8_PENRF (Carbohydrate-binding WSC n=2 Tax=Penicillium roqueforti TaxID=5082 RepID=W6Q5D8_PENRF) HSP 1 Score: 50.1 bits (118), Expect = 1.400e-5 Identity = 21/52 (40.38%), Postives = 32/52 (61.54%), Query Frame = 0 Query: 20 ALAEGSACYCGNPQPVDEER---GICEEPCAGDVSSVCGGVNSYDLYEIADN 68 AL+ G+ CYCGN P D + C+ PCAG + CGG ++++L + A+N Sbjct: 61 ALSRGNMCYCGNEMPPDSAKIADSKCDVPCAGWPAGSCGGADTFNLIQAAEN 112
BLAST of mRNA_L-elsbetiae_contig720.16047.1 vs. uniprot
Match: A0A6H5KL41_9PHAE (WSC domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KL41_9PHAE) HSP 1 Score: 49.7 bits (117), Expect = 2.200e-5 Identity = 20/52 (38.46%), Postives = 30/52 (57.69%), Query Frame = 0 Query: 19 FALAEGSACYCGNPQPV----DEERGICEEPCAGDVSSVCGGVNSYDLYEIA 66 FA+ G C C D + G+C+ PC GD S CGGV+S+D+Y+++ Sbjct: 138 FAVTRGDLCTCFTEADTGIFDDRKGGVCDAPCTGDSSQPCGGVDSFDVYQLS 189 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig720.16047.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 4
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig720.16047.1 ID=prot_L-elsbetiae_contig720.16047.1|Name=mRNA_L-elsbetiae_contig720.16047.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=68bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|