prot_L-elsbetiae_contig7079.15883.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig7079.15883.1 vs. uniprot
Match: A0A6H5L6R2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L6R2_9PHAE) HSP 1 Score: 82.0 bits (201), Expect = 1.500e-16 Identity = 48/58 (82.76%), Postives = 49/58 (84.48%), Query Frame = 0 Query: 1 MYRGN--QSMGPRHG-HMTHGYMNTMGMQAPPPDGS-PLG-QGMMGRYGMQVPAGGPA 53 MYRGN QSMGPRHG HM G+MN MGMQAPPPDGS PL QGMMGRYGMQVPAGGPA Sbjct: 46 MYRGNNNQSMGPRHGGHMNPGFMNNMGMQAPPPDGSSPLTHQGMMGRYGMQVPAGGPA 103
BLAST of mRNA_L-elsbetiae_contig7079.15883.1 vs. uniprot
Match: D7FVL9_ECTSI (Xel-1 protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FVL9_ECTSI) HSP 1 Score: 82.4 bits (202), Expect = 3.620e-16 Identity = 48/57 (84.21%), Postives = 49/57 (85.96%), Query Frame = 0 Query: 1 MYRGN-QSMGPRHG-HMTHGYMNTMGMQAPPPDGS-PLG-QGMMGRYGMQVPAGGPA 53 MYRGN QSMGPRHG HM G+MN MGMQAPPPDGS PL QGMMGRYGMQVPAGGPA Sbjct: 334 MYRGNNQSMGPRHGGHMNPGFMNNMGMQAPPPDGSSPLTHQGMMGRYGMQVPAGGPA 390 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig7079.15883.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig7079.15883.1 ID=prot_L-elsbetiae_contig7079.15883.1|Name=mRNA_L-elsbetiae_contig7079.15883.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=104bpback to top |