prot_L-elsbetiae_contig696.15734.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig696.15734.1 vs. uniprot
Match: A0A6H5KXK5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KXK5_9PHAE) HSP 1 Score: 82.8 bits (203), Expect = 6.960e-17 Identity = 43/60 (71.67%), Postives = 49/60 (81.67%), Query Frame = 0 Query: 18 VDLIFEVLTSEEWAGLLGAPLERAVAKGHRDLAQRLVRAGAEIGDALHEAIRSGHIEIVS 77 VD IFE+LTS++ A LL A LE A AKG++DLAQRLVRAGAEIGDALH A+ GH EIVS Sbjct: 2 VDFIFEILTSQQLAELLRALLEHAAAKGNKDLAQRLVRAGAEIGDALHRAVDGGHREIVS 61
BLAST of mRNA_L-elsbetiae_contig696.15734.1 vs. uniprot
Match: D8LL12_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LL12_ECTSI) HSP 1 Score: 82.0 bits (201), Expect = 1.060e-16 Identity = 40/77 (51.95%), Postives = 56/77 (72.73%), Query Frame = 0 Query: 1 MSDKIGREALRGAEGHAVDLIFEVLTSEEWAGLLGAPLERAVAKGHRDLAQRLVRAGAEIGDALHEAIRSGHIEIVS 77 ++++ GR AL+GAEG DL EVLT+ WA +L PLE A A+G+ L Q+L+RAGA++G ALH A+R GH E+V+ Sbjct: 17 LANEQGRRALKGAEGETFDLFSEVLTTHGWAEMLQFPLECAAAQGNVALTQKLLRAGADMGSALHAAVRYGHAEVVT 93
BLAST of mRNA_L-elsbetiae_contig696.15734.1 vs. uniprot
Match: D7FKL4_ECTSI (Ankyrin repeat protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FKL4_ECTSI) HSP 1 Score: 73.9 bits (180), Expect = 1.010e-13 Identity = 36/75 (48.00%), Postives = 48/75 (64.00%), Query Frame = 0 Query: 1 MSDKIGREALRGAEGHAVDLIFEVLTSEEWAGLLGAPLERAVAKGHRDLAQRLVRAGAEIGDALHEAIRSGHIEI 75 M+++ R ALRG E DL E T ++WAGL+ LE A +GH L ++LV AGAEIG A+H A+R GH +I Sbjct: 1 MANECARGALRGEEERIFDLAAETCTPKQWAGLMQPFLEHAAGRGHEHLTRKLVEAGAEIGTAVHAAVRGGHCDI 75 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig696.15734.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig696.15734.1 ID=prot_L-elsbetiae_contig696.15734.1|Name=mRNA_L-elsbetiae_contig696.15734.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=77bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|