mRNA_L-elsbetiae_contig696.15734.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig696.15734.1 vs. uniprot
Match: D8LL12_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LL12_ECTSI) HSP 1 Score: 87.0 bits (214), Expect = 9.280e-18 Identity = 44/87 (50.57%), Postives = 62/87 (71.26%), Query Frame = 2 Query: 119 FSRHPAARR-MSDKIGREALRGAEGHAVDLIFEVLTSEEWAGLLGAPLERAVAKGHRDLAQRLVRAGAEIGDALHEAIRSGHIEIVS 376 FSRH ++ ++++ GR AL+GAEG DL EVLT+ WA +L PLE A A+G+ L Q+L+RAGA++G ALH A+R GH E+V+ Sbjct: 7 FSRHTCSQNALANEQGRRALKGAEGETFDLFSEVLTTHGWAEMLQFPLECAAAQGNVALTQKLLRAGADMGSALHAAVRYGHAEVVT 93
BLAST of mRNA_L-elsbetiae_contig696.15734.1 vs. uniprot
Match: A0A6H5KXK5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KXK5_9PHAE) HSP 1 Score: 82.8 bits (203), Expect = 4.150e-16 Identity = 43/60 (71.67%), Postives = 49/60 (81.67%), Query Frame = 2 Query: 197 VDLIFEVLTSEEWAGLLGAPLERAVAKGHRDLAQRLVRAGAEIGDALHEAIRSGHIEIVS 376 VD IFE+LTS++ A LL A LE A AKG++DLAQRLVRAGAEIGDALH A+ GH EIVS Sbjct: 2 VDFIFEILTSQQLAELLRALLEHAAAKGNKDLAQRLVRAGAEIGDALHRAVDGGHREIVS 61
BLAST of mRNA_L-elsbetiae_contig696.15734.1 vs. uniprot
Match: D7FKL4_ECTSI (Ankyrin repeat protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FKL4_ECTSI) HSP 1 Score: 75.1 bits (183), Expect = 2.240e-13 Identity = 36/75 (48.00%), Postives = 48/75 (64.00%), Query Frame = 2 Query: 146 MSDKIGREALRGAEGHAVDLIFEVLTSEEWAGLLGAPLERAVAKGHRDLAQRLVRAGAEIGDALHEAIRSGHIEI 370 M+++ R ALRG E DL E T ++WAGL+ LE A +GH L ++LV AGAEIG A+H A+R GH +I Sbjct: 1 MANECARGALRGEEERIFDLAAETCTPKQWAGLMQPFLEHAAGRGHEHLTRKLVEAGAEIGTAVHAAVRGGHCDI 75 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig696.15734.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig696.15734.1 >prot_L-elsbetiae_contig696.15734.1 ID=prot_L-elsbetiae_contig696.15734.1|Name=mRNA_L-elsbetiae_contig696.15734.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=77bp MSDKIGREALRGAEGHAVDLIFEVLTSEEWAGLLGAPLERAVAKGHRDLAback to top mRNA from alignment at L-elsbetiae_contig696:16387..16762+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig696.15734.1 ID=mRNA_L-elsbetiae_contig696.15734.1|Name=mRNA_L-elsbetiae_contig696.15734.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=376bp|location=Sequence derived from alignment at L-elsbetiae_contig696:16387..16762+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig696:16387..16762+ >mRNA_L-elsbetiae_contig696.15734.1 ID=mRNA_L-elsbetiae_contig696.15734.1|Name=mRNA_L-elsbetiae_contig696.15734.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=462bp|location=Sequence derived from alignment at L-elsbetiae_contig696:16387..16762+ (Laminarionema elsbetiae ELsaHSoW15)back to top |