prot_L-elsbetiae_contig6909.15679.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig6909.15679.1 vs. uniprot
Match: A0A6H5L4C8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L4C8_9PHAE) HSP 1 Score: 72.4 bits (176), Expect = 1.040e-12 Identity = 46/83 (55.42%), Postives = 50/83 (60.24%), Query Frame = 0 Query: 21 LRGYILSSKPACGGGSSTSIAPAQLTWRAVAARK----AKLATSVRFGGVGDIQANLVRAEKSQLVERDREGASLLMHAAQRG 99 L G L S P G +P A A + AKL TSVRFGGVGDI+ANL RA+K QLV RD EG SLLMHAAQRG Sbjct: 483 LGGVQLLSSPGGTGALDAFCSPLSEATAAAAGSEMTHAAKLKTSVRFGGVGDIRANLGRADKQQLVSRDGEGVSLLMHAAQRG 565
BLAST of mRNA_L-elsbetiae_contig6909.15679.1 vs. uniprot
Match: D7FHF4_ECTSI (Ankyrin n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FHF4_ECTSI) HSP 1 Score: 70.5 bits (171), Expect = 4.900e-12 Identity = 37/45 (82.22%), Postives = 39/45 (86.67%), Query Frame = 0 Query: 55 AKLATSVRFGGVGDIQANLVRAEKSQLVERDREGASLLMHAAQRG 99 AKL TSVRFGGVGDI+ANL RA+K QLV RD EG SLLMHAAQRG Sbjct: 287 AKLKTSVRFGGVGDIRANLGRADKPQLVSRDGEGVSLLMHAAQRG 331 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig6909.15679.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig6909.15679.1 ID=prot_L-elsbetiae_contig6909.15679.1|Name=mRNA_L-elsbetiae_contig6909.15679.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=99bpback to top |